DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and NAS2

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_012259.3 Gene:NAS2 SGDID:S000001269 Length:220 Species:Saccharomyces cerevisiae

Alignment Length:215 Identity:57/216 (26%)
Similarity:97/216 (45%) Gaps:40/216 (19%)


  Fly    10 RLERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDH 74
            :|..|:..|..:|.|:.....:| ....:||...||..:|:||:|:||.||.:.|:.:..|:||.
Yeast    30 KLSELMVLKTDIETQLEAYFSVL-EQQGIGMDSALVTPDGYPRSDVDVLQVTMIRKNVNMLKNDL 93

  Fly    75 KELMNQIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSP 139
            ..|:.:...||||:...:.....:          |:.|:.....|....|   ...::.|.|.||
Yeast    94 NHLLQRSHVLLNQHFDNMNVKSNQ----------DARRNNDDQAIQYTIP---FAFISEVVPGSP 145

  Fly   140 AERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGE------------QQL 192
            :::|.:...|.::..|::::.|             :.:.||:|:.|.:.|            |.|
Yeast   146 SDKADIKVDDKLISIGNVHAAN-------------HSKLQNIQMVVMKNEDRPLPVLLLREGQIL 197

  Fly   193 DLILVP-KTWSGRGLLGCNI 211
            ...|.| :.|:|||||||.|
Yeast   198 KTSLTPSRNWNGRGLLGCRI 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 14/70 (20%)
NAS2NP_012259.3 PDZ 106..182 CDD:278991 17/102 (17%)
DegQ <135..204 CDD:223343 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192189799
eggNOG 1 0.900 E1_COG0265
Hieranoid 1 1.000
Homologene 1 1.000 H2106
Inparanoid 1 1.050 82 1.000 Inparanoid score I1586
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003222
OrthoInspector 1 1.000 T1136339
orthoMCL 1 0.900 OOG5_128010
Panther 1 1.100 LDO PTHR12651
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1021
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.