DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and NAS2

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_012259.3 Gene:NAS2 / 854810 SGDID:S000001269 Length:220 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:57/215 - (26%)
Similarity:97/215 - (45%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RLERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDH 74
            :|..|:..|..:|.|:.....:| ....:||...||..:|:||:|:||.||.:.|:.:..|:||.
Yeast    30 KLSELMVLKTDIETQLEAYFSVL-EQQGIGMDSALVTPDGYPRSDVDVLQVTMIRKNVNMLKNDL 93

  Fly    75 KELMNQIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSP 139
            ..|:.:...||||:...:.....:          |:.|:.....|....|   ...::.|.|.||
Yeast    94 NHLLQRSHVLLNQHFDNMNVKSNQ----------DARRNNDDQAIQYTIP---FAFISEVVPGSP 145

  Fly   140 AERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGE------------QQL 192
            :::|.:...|.::..|::::.|             :.:.||:|:.|.:.|            |.|
Yeast   146 SDKADIKVDDKLISIGNVHAAN-------------HSKLQNIQMVVMKNEDRPLPVLLLREGQIL 197

  Fly   193 DLILVP-KTWSGRGLLGCNI 211
            ...|.| :.|:|||||||.|
Yeast   198 KTSLTPSRNWNGRGLLGCRI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 Nas2_N 11..90 CDD:465689 27/78 (35%)
RseP <130..>208 CDD:440513 22/90 (24%)
NAS2NP_012259.3 Nas2_N 31..109 CDD:465689 27/78 (35%)
RseP <131..>214 CDD:440513 23/98 (23%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 1 1.000 - -
eggNOG 1 0.900 - -
Hieranoid 1 1.000 - -