DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and NAS2

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_012259.3 Gene:NAS2 / 854810 SGDID:S000001269 Length:220 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:57/215 - (26%)
Similarity:97/215 - (45%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RLERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDH 74
            :|..|:..|..:|.|:.....:| ....:||...||..:|:||:|:||.||.:.|:.:..|:||.
Yeast    30 KLSELMVLKTDIETQLEAYFSVL-EQQGIGMDSALVTPDGYPRSDVDVLQVTMIRKNVNMLKNDL 93

  Fly    75 KELMNQIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSP 139
            ..|:.:...||||:...:.....:          |:.|:.....|....|   ...::.|.|.||
Yeast    94 NHLLQRSHVLLNQHFDNMNVKSNQ----------DARRNNDDQAIQYTIP---FAFISEVVPGSP 145

  Fly   140 AERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGE------------QQL 192
            :::|.:...|.::..|::::.|             :.:.||:|:.|.:.|            |.|
Yeast   146 SDKADIKVDDKLISIGNVHAAN-------------HSKLQNIQMVVMKNEDRPLPVLLLREGQIL 197

  Fly   193 DLILVP-KTWSGRGLLGCNI 211
            ...|.| :.|:|||||||.|
Yeast   198 KTSLTPSRNWNGRGLLGCRI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 13/69 (19%)
NAS2NP_012259.3 Nas2_N 31..109 CDD:408080 27/78 (35%)
PDZ 106..182 CDD:395476 17/101 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344316
Domainoid 1 1.000 52 1.000 Domainoid score I2825
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2106
Inparanoid 1 1.050 81 1.000 Inparanoid score I1611
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54093
OrthoFinder 1 1.000 - - FOG0004887
OrthoInspector 1 1.000 - - oto99269
orthoMCL 1 0.900 - - OOG6_102356
Panther 1 1.100 - - LDO PTHR12651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1021
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.