DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and si:dkey-84o3.7

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_017208436.1 Gene:si:dkey-84o3.7 ZFINID:ZDB-GENE-091113-30 Length:200 Species:Danio rerio

Alignment Length:171 Identity:36/172 (21%)
Similarity:67/172 (39%) Gaps:33/172 (19%)


  Fly    42 GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKEL-MNQIQTLLNQYHSE-----------IAT 94
            |||::.:|   ..||:..:::.......:.:|...| :::.......:..|           :.|
Zfish    49 GPLINLDG---EVIDINTMKVTAGISFAIPSDRVRLFLDRSADKQKSWFGESGWKRRYIGVMMLT 110

  Fly    95 TDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFGSINS 159
            ..|.::......|         .:..|:...   |:::.|...|||.|||:..||.|:....:..
Zfish   111 LTPSIIEELRMRD---------PSFHDVFHG---VLIHRVIVGSPANRAGMKPGDVIIEINGVKV 163

  Fly   160 GNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPKT 200
            ...:    :|...||..:|.||  .|:||...|.|.:.|::
Zfish   164 NTSE----EIYNAVRTSESLNV--VVRRGADLLMLHMTPES 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 19/70 (27%)
si:dkey-84o3.7XP_017208436.1 Trypsin_2 <1..59 CDD:290102 4/13 (31%)
PDZ_serine_protease 102..186 CDD:238487 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.