DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and htra3b

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_073763543.1 Gene:htra3b / 573378 ZFINID:ZDB-GENE-110602-1 Length:466 Species:Danio rerio


Alignment Length:213 Identity:43/213 - (20%)
Similarity:78/213 - (36%) Gaps:78/213 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RNGQILAAND------------NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQND----- 73
            |:|:.|...|            |.|.| ||||:.:|   ..|.:..:::|......:.:|     
Zfish   288 RDGKELGLQDSDMDYIQTDAIINYGNSGGPLVNLDG---EVIGINTLKVAAGISFAIPSDRITRF 349

  Fly    74 --------HKELMN--------QIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDL 122
                    :||..:        ::.|:.:....|:...:|:.          .|.|.|       
Zfish   350 LNDSLGKQNKETRSVKKRFIGIRMLTITDALVEELKQQNPDF----------PDVSSG------- 397

  Fly   123 APARAIVVVNLVSPDSPAERAGLCAGDAILRFGS---INSGNFKGDLAQIGELVRNMQSQNVQLK 184
                  :.|:.|.|.|||::.|:..||.|::...   :::.:.|..|         .|...:.|:
Zfish   398 ------IFVHEVVPHSPAQKGGIRDGDIIVKLNGEPLLSTSDLKEAL---------NQDMTLLLE 447

  Fly   185 VKRGEQQL------DLIL 196
            |:||...|      |:|:
Zfish   448 VRRGNDDLLFNIEPDIIM 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 Nas2_N 11..90 CDD:465689 18/96 (19%)
RseP <130..>208 CDD:440513 20/76 (26%)
htra3bXP_073763543.1 None


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.