DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and htra1b

DIOPT Version :10

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001104652.1 Gene:htra1b / 565082 ZFINID:ZDB-GENE-080219-7 Length:476 Species:Danio rerio


Alignment Length:180 Identity:38/180 - (21%)
Similarity:67/180 - (37%) Gaps:44/180 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELMNQIQTLLNQYHSEIA------- 93
            |.|.| ||||:.:|   ..|.:..:::.......:.:|      :|:..|.:.|...|       
Zfish   320 NYGNSGGPLVNLDG---EVIGINTLKVTAGISFAIPSD------KIRQFLAESHDRQAKGKTATK 375

  Fly    94 ---------TTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGD 149
                     |..|.|.........|......||.:.:            |.|.:|||..||...|
Zfish   376 KKYIGVRMMTLTPTLAKELKQRKNDFPDVTSGAYVIE------------VIPKTPAEVGGLKESD 428

  Fly   150 AILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199
            .|:   ||| |......:.:...::.  .::::..|:||.:.:.|.::|:
Zfish   429 VII---SIN-GQRITSASDVSTAIKT--DESLRAVVRRGNEDIILTIIPE 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 Nas2_N 11..90 CDD:465689 12/53 (23%)
RseP <130..>208 CDD:440513 18/70 (26%)
htra1bNP_001104652.1 IGFBP 29..85 CDD:459717
KAZAL_FS 109..151 CDD:238052
DegQ 198..473 CDD:440035 38/180 (21%)
Serine protease. /evidence=ECO:0000250 200..360 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.