DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and htra1b

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001104652.1 Gene:htra1b ZFINID:ZDB-GENE-080219-7 Length:476 Species:Danio rerio

Alignment Length:180 Identity:38/181 (21%)
Similarity:67/181 (37%) Gaps:44/181 (24%)


  Fly    37 NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELMNQIQTLLNQYHSEIA------- 93
            |.|.| ||||:.:|   ..|.:..:::.......:.:|      :|:..|.:.|...|       
Zfish   320 NYGNSGGPLVNLDG---EVIGINTLKVTAGISFAIPSD------KIRQFLAESHDRQAKGKTATK 375

  Fly    94 ---------TTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGD 149
                     |..|.|.........|......||.:.:            |.|.:|||..||...|
Zfish   376 KKYIGVRMMTLTPTLAKELKQRKNDFPDVTSGAYVIE------------VIPKTPAEVGGLKESD 428

  Fly   150 AILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199
            .|:   ||| |......:.:...::.  .::::..|:||.:.:.|.::|:
Zfish   429 VII---SIN-GQRITSASDVSTAIKT--DESLRAVVRRGNEDIILTIIPE 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 16/70 (23%)
htra1bNP_001104652.1 IGFBP 29..85 CDD:278641
KAZAL_FS 109..151 CDD:238052
DegQ 155..476 CDD:223343 38/181 (21%)
Serine protease. {ECO:0000250} 200..360 11/49 (22%)
Trypsin_2 200..338 CDD:290102 9/21 (43%)
PDZ_serine_protease 378..469 CDD:238487 23/109 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.