DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and htra3a

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001003502.1 Gene:htra3a ZFINID:ZDB-GENE-040801-245 Length:489 Species:Danio rerio

Alignment Length:208 Identity:49/209 (23%)
Similarity:84/209 (40%) Gaps:48/209 (23%)


  Fly    27 RNGQILAAND------------NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQND--HKE 76
            |:|:.|...|            |.|.| ||||:.:|   ..|.:..:::.......:.:|  :|.
Zfish   291 RDGKELGIRDSDMGYIQTDAIINYGNSGGPLVNLDG---EVIGINTLKVTAGISFAIPSDRINKF 352

  Fly    77 L--MNQIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANIT-----------------DL 122
            |  .|..|..:.|.......|..:.:..||.:::...|..|...:|                 |:
Zfish   353 LDESNDKQQKVKQRVVRTNYTQSQAMRTASDVNVPMKRFIGIKMVTLTENLVHELKWHNPAFPDI 417

  Fly   123 APARAIVVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQ-SQNVQLKVK 186
            ...   ::|:.|..||||::.||.:||.|::.    :|:   .|...|||...:| ...:.|:|:
Zfish   418 GSG---ILVHEVIADSPAQKGGLESGDIIVKL----NGH---PLMNTGELQEAIQVDMPLLLEVR 472

  Fly   187 RGEQQLDLILVPK 199
            ||...|...:.|:
Zfish   473 RGNDDLLFNIEPQ 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 21/88 (24%)
htra3aNP_001003502.1 IGFBP 26..77 CDD:278641
KAZAL_FS 92..135 CDD:238052
Trypsin_2 187..331 CDD:290102 13/43 (30%)
PDZ_serine_protease 390..475 CDD:238487 25/95 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.