DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and psmd9

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001002436.2 Gene:psmd9 ZFINID:ZDB-GENE-030131-431 Length:211 Species:Danio rerio

Alignment Length:206 Identity:83/207 (40%)
Similarity:123/207 (59%) Gaps:13/207 (6%)


  Fly     7 TKERLERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQ 71
            |:|.:.:||..|..:|.||.....:|.:...|||.|||||.|||||.|:|:|:||.||.:|.|||
Zfish    15 TEEDVRQLIKRKDDIEEQIKAYYDMLESQAGVGMDGPLVDVEGFPRADVDLYKVRTARHSISCLQ 79

  Fly    72 NDHKELMNQIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSP 136
            ||||.:|.:|:..|::.|:....|..:          |..:........:..|..|:  |:.|:.
Zfish    80 NDHKAIMVEIEEALHKLHATAKVTHEQ----------DDTQMESSGQTVETPPPFAL--VDAVTH 132

  Fly   137 DSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPKTW 201
            .|||.:|||..||.|:.|||:|:.||: :|..|..:|::.:.:::::.|.|..|::.|.|.|:.|
Zfish   133 GSPAAQAGLHVGDQIMEFGSVNTQNFR-NLRDIASVVQHSEGKSLRVGVFRNGQEVHLNLTPQQW 196

  Fly   202 SGRGLLGCNIV 212
            |||||||||||
Zfish   197 SGRGLLGCNIV 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 23/70 (33%)
psmd9NP_001002436.2 DegQ <50..198 CDD:223343 61/161 (38%)
PDZ_metalloprotease 117..193 CDD:238489 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192178150
eggNOG 1 0.900 E1_COG0265
Hieranoid 1 1.000
Homologene 1 1.000 H2106
Inparanoid 1 1.050 151 1.000 Inparanoid score I4263
OMA 1 1.010
OrthoDB 1 1.010 D1405146at2759
OrthoFinder 1 1.000 FOG0003222
OrthoInspector 1 1.000 T1053322
orthoMCL 1 0.900 OOG5_128010
Panther 1 1.100 LDO PTHR12651
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1021
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.