DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and Htra4

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001074656.1 Gene:Htra4 MGIID:3036260 Length:483 Species:Mus musculus

Alignment Length:236 Identity:54/237 (23%)
Similarity:79/237 (33%) Gaps:88/237 (37%)


  Fly     1 MAAG-TTTKERLERLINAKK------QLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVY 58
            :.|| .:|.:|..|.:..|.      |.:|.||        :.|.|  ||||:.:|      ||.
Mouse   296 VTAGIVSTTQRGGRELGLKNSDIDYIQTDAIIN--------HGNSG--GPLVNLDG------DVI 344

  Fly    59 QVRLARQTI---ICLQNDHKELMNQIQTLLNQYH---------------------------SEIA 93
            .:...:.|.   ..:.:|      :|:..|..||                           .|:.
Mouse   345 GINTLKVTAGISFAIPSD------RIRQFLEDYHERQLKGKAPLQKKYLGLRMLPLTLNLLQEMK 403

  Fly    94 TTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFGSIN 158
            ..|||.          .|.|.|             |.|..|...|.|..:||...|.|:   |||
Mouse   404 RQDPEF----------PDVSSG-------------VFVYEVIQGSAAASSGLRDHDVIV---SIN 442

  Fly   159 SGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199
             |........:.|.|::  :..:.:.|.||.|.|.|.:.|:
Mouse   443 -GQPVTTTTDVIEAVKD--NDFLSIIVLRGSQTLFLTVTPE 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 16/70 (23%)
Htra4NP_001074656.1 IGFBP 39..93 CDD:278641
KAZAL <121..>140 CDD:197624
DegQ 145..479 CDD:223343 53/234 (23%)
Serine protease. {ECO:0000250} 208..368 22/94 (23%)
Trypsin_2 208..346 CDD:290102 19/66 (29%)
PDZ_serine_protease 386..477 CDD:238487 28/120 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.