DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and Psmd9

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_569114.1 Gene:Psmd9 RGDID:621110 Length:222 Species:Rattus norvegicus

Alignment Length:211 Identity:89/212 (42%)
Similarity:127/212 (60%) Gaps:26/212 (12%)


  Fly    11 LERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHK 75
            ::.|:..|:::||||..|..:|.:...:||:.||||.||:||.|:|:||||.||..|||||||||
  Rat    23 IQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRADVDLYQVRTARHNIICLQNDHK 87

  Fly    76 ELMNQIQTLLNQYHS--------EIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVN 132
            .||.|::..|:|.|:        ::|....|.:||..|.|     ||        |..:|...||
  Rat    88 ALMKQVEEALHQLHARDKEKQARDMAEAREEAMNRRLASD-----SP--------ALPKAFARVN 139

  Fly   133 LVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQ--NVQLKVKRGEQQLDLI 195
            .:||.|||..|||...|.|:.|||:|:.||: .|..:|.:|::.:.:  ||.: ::|||:. .|.
  Rat   140 SISPGSPASIAGLQVDDEIVEFGSVNTQNFQ-SLQNVGTVVQHSEGKPLNVMV-IRRGEKH-QLR 201

  Fly   196 LVPKTWSGRGLLGCNI 211
            |.|..|:|:|||||||
  Rat   202 LTPTRWAGKGLLGCNI 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 25/72 (35%)
Psmd9NP_569114.1 PDZ_metalloprotease 132..204 CDD:238489 29/75 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C192176046
eggNOG 1 0.900 E1_COG0265
Hieranoid 1 1.000
Homologene 1 1.000 H2106
Inparanoid 1 1.050 152 1.000 Inparanoid score I4199
OMA 1 1.010
OrthoDB 1 1.010 D1405146at2759
OrthoFinder 1 1.000 FOG0003222
OrthoInspector 1 1.000 T1087687
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12651
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.