DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and htra4

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_002932829.1 Gene:htra4 XenbaseID:XB-GENE-962552 Length:469 Species:Xenopus tropicalis

Alignment Length:202 Identity:43/203 (21%)
Similarity:71/203 (35%) Gaps:56/203 (28%)


  Fly    27 RNGQILAAND------------NVGMS-GPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELM 78
            |.|:.|...|            |.|.| ||||:.:|   ..|.:..:::.......:.:|     
 Frog   292 RGGKELGLKDSDMEYIQTDAIINYGNSGGPLVNLDG---EVIGINTLKVTAGISFAIPSD----- 348

  Fly    79 NQIQTLLNQYHS----------------EIATTDPELVNRASALDLDSDRSPGGANITDLAPARA 127
             :|:..|.:.|.                .:......|:......|            .|.....|
 Frog   349 -RIRQFLAESHDRQTKGKMLPKKKYMGVRMLQLSSNLIRELKTRD------------KDFPDVNA 400

  Fly   128 IVVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQL 192
            .|.|..|.|.:.|..||:...|.|:   |:| |.......::.|.|||  :..:.:.|:||.:.:
 Frog   401 GVYVFEVIPGTAAASAGMKDHDVII---SLN-GKMVSSTEEVSEAVRN--NDTLSIVVRRGNEDI 459

  Fly   193 DLILVPK 199
            .|.:||:
 Frog   460 ILNVVPE 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 19/70 (27%)
htra4XP_002932829.1 IGFBP 31..84 CDD:278641
KAZAL 99..145 CDD:197624
DegQ 152..467 CDD:223343 43/203 (21%)
Trypsin_2 194..332 CDD:290102 13/43 (30%)
PDZ_serine_protease 372..463 CDD:238487 24/109 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.