DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9588 and LOC100331049

Sequence 1:NP_650301.1 Gene:CG9588 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_002665901.2 Gene:LOC100331049 ID: Length:301 Species:Danio rerio

Alignment Length:72 Identity:23/73 (32%)
Similarity:36/73 (49%) Gaps:6/73 (8%)


  Fly   129 VVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLD 193
            |:::.|...|||.|||:..||.|:....:.....:    :|...||..:|.||  .|:||...|.
Zfish   234 VLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSE----EIYNAVRTSESLNV--VVRRGADLLM 292

  Fly   194 LILVPKT 200
            |.:.|::
Zfish   293 LHMTPES 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 18/57 (32%)
LOC100331049XP_002665901.2 Trypsin_2 24..162 CDD:290102
PDZ_serine_protease 203..287 CDD:238487 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.