DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and htra2-3

DIOPT Version :10

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001103205.2 Gene:htra2-3 / 100003308 ZFINID:ZDB-GENE-081028-21 Length:200 Species:Danio rerio


Alignment Length:108 Identity:30/108 - (27%)
Similarity:45/108 - (41%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TTDPELVNRASALDLD-SDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFGSI 157
            |..|.::......||. .|.|.|             |:::.|...|||.|||:..||.|:....:
Zfish   110 TLTPSIIKELRMRDLSFPDVSHG-------------VLIHRVIVGSPANRAGMKPGDVIIEINGV 161

  Fly   158 NSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPKT 200
            .....:    :|...||..:|.||  .|:||...|.|.:.|::
Zfish   162 KVNTSE----EIYNAVRTSESLNV--VVRRGADLLMLHMTPES 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 Nas2_N 11..90 CDD:465689
RseP <130..>208 CDD:440513 22/71 (31%)
htra2-3NP_001103205.2 DegQ <1..197 CDD:440035 29/105 (28%)
cpPDZ_HtrA-like 101..198 CDD:467624 30/106 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.