DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and si:dkey-33c12.12

DIOPT Version :9

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio


Alignment Length:75 Identity:24/75 - (32%)
Similarity:37/75 - (49%) Gaps:6/75 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLD 193
            |:::.|...|||.|||:..||.|:....:.....:    :|...||..:|.||  .|:||...|.
Zfish   133 VLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSE----EIYNAVRTSESLNV--VVRRGADLLM 191

  Fly   194 LILVPKTWSG 203
            |.:.|::..|
Zfish   192 LHMTPESTEG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 PDZ 116..186 CDD:238080 17/56 (30%)
si:dkey-33c12.12NP_001082916.2 Trypsin_2 <1..61 CDD:290102
PDZ_serine_protease 102..186 CDD:238487 18/58 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.