powered by:
Protein Alignment CG9588 and si:dkey-33c12.12
DIOPT Version :9
Sequence 1: | NP_650301.1 |
Gene: | CG9588 / 41672 |
FlyBaseID: | FBgn0038166 |
Length: | 220 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001082916.2 |
Gene: | si:dkey-33c12.12 / 100000024 |
ZFINID: | ZDB-GENE-081028-30 |
Length: | 214 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 24/75 - (32%) |
Similarity: | 37/75 - (49%) |
Gaps: | 6/75 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 VVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLD 193
|:::.|...|||.|||:..||.|:....:.....: :|...||..:|.|| .|:||...|.
Zfish 133 VLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSE----EIYNAVRTSESLNV--VVRRGADLLM 191
Fly 194 LILVPKTWSG 203
|.:.|::..|
Zfish 192 LHMTPESTEG 201
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0265 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.