DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9588 and si:dkey-33c12.12

DIOPT Version :10

Sequence 1:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001082916.2 Gene:si:dkey-33c12.12 / 100000024 ZFINID:ZDB-GENE-081028-30 Length:214 Species:Danio rerio


Alignment Length:75 Identity:24/75 - (32%)
Similarity:37/75 - (49%) Gaps:6/75 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLD 193
            |:::.|...|||.|||:..||.|:....:.....:    :|...||..:|.||  .|:||...|.
Zfish   133 VLIHRVIVGSPANRAGMKPGDVIIEINGVKVNTSE----EIYNAVRTSESLNV--VVRRGADLLM 191

  Fly   194 LILVPKTWSG 203
            |.:.|::..|
Zfish   192 LHMTPESTEG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9588NP_650301.1 Nas2_N 11..90 CDD:465689
RseP <130..>208 CDD:440513 23/74 (31%)
si:dkey-33c12.12NP_001082916.2 DegQ <1..197 CDD:440035 22/69 (32%)
cpPDZ_HtrA-like 101..198 CDD:467624 23/70 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.