DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbp4 and cirbp

Sequence 1:NP_476935.1 Gene:Rbp4 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001017228.1 Gene:cirbp XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis

Alignment Length:170 Identity:50/171 (29%)
Similarity:79/171 (46%) Gaps:34/171 (20%)


  Fly    25 EEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIV 89
            :||     |:|:|||:.:||.|:|...||::|.||:.||::|..|..||||||||:.:|:..:..
 Frog     4 DEG-----KLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDA 63

  Fly    90 QRA-RPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEY------- 146
            ..| ...::|.:.:....|....:.:|||..|   ||.|....|...:....||.:.|       
 Frog    64 MMAMNGKSVDGRQIRVDQAGKSSNDRRGGYRG---GSSGGRGFFRGGRGRGGGGDRGYGGSSRFE 125

  Fly   147 -----HDENIVREYFSQ----FGPVASVKLLMDRETGRQR 177
                 :..:..|:|:.:    :|         ||..|..|
 Frog   126 NRSGGYQSSGSRDYYGRSHGSYG---------DRSGGSYR 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 30/78 (38%)
RRM2_hnRNPA_like 137..209 CDD:240774 10/58 (17%)
cirbpNP_001017228.1 RRM <4..>87 CDD:223796 32/88 (36%)
RRM_CIRBP_RBM3 6..85 CDD:240895 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0118
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.