DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and cirbp

DIOPT Version :9

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001017228.1 Gene:cirbp / 549982 XenbaseID:XB-GENE-492781 Length:166 Species:Xenopus tropicalis


Alignment Length:170 Identity:50/170 - (29%)
Similarity:79/170 - (46%) Gaps:34/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIV 89
            :||     |:|:|||:.:||.|:|...||::|.||:.||::|..|..||||||||:.:|:..:..
 Frog     4 DEG-----KLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDA 63

  Fly    90 QRA-RPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEY------- 146
            ..| ...::|.:.:....|....:.:|||..|   ||.|....|...:....||.:.|       
 Frog    64 MMAMNGKSVDGRQIRVDQAGKSSNDRRGGYRG---GSSGGRGFFRGGRGRGGGGDRGYGGSSRFE 125

  Fly   147 -----HDENIVREYFSQ----FGPVASVKLLMDRETGRQR 177
                 :..:..|:|:.:    :|         ||..|..|
 Frog   126 NRSGGYQSSGSRDYYGRSHGSYG---------DRSGGSYR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 34..105 CDD:473069 28/71 (39%)
RRM2_hnRNPA_like 137..209 CDD:409766 10/57 (18%)
cirbpNP_001017228.1 RRM_CIRBP_RBM3 6..85 CDD:409883 31/83 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..166 20/101 (20%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.