DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp4 and SLIRP2

DIOPT Version :10

Sequence 1:NP_476935.1 Gene:Rbp4 / 41668 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:85 Identity:23/85 - (27%)
Similarity:47/85 - (55%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 AGFMNSK-RIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKA 193
            :||:.|. ::|:|.|........:|.|||::|.||:.:::.||:.|..:.:||:.|....:...|
  Fly     3 SGFVRSSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSA 67

  Fly   194 LAPRKHWILQTLVEVKRSTQ 213
            .....|::...::.|:|:.:
  Fly    68 SNQNTHFLDGRVLTVQRANE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 34..105 CDD:473069
RRM2_hnRNPA_like 137..209 CDD:409766 18/71 (25%)
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 18/71 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.