DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbp4 and Larp7

Sequence 1:NP_476935.1 Gene:Rbp4 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_613059.2 Gene:Larp7 MGIID:107634 Length:570 Species:Mus musculus

Alignment Length:163 Identity:37/164 (23%)
Similarity:60/164 (37%) Gaps:39/164 (24%)


  Fly   152 VREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKAL---------APRKHWILQTLVE 207
            :...|.:.|.|..:.:...:.||..:.|.|:||.....|.||:         ||||..|....|:
Mouse   135 IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVK 199

  Fly   208 VK---------RSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAF 263
            .|         ...:|..::.|.....||:|     :.:..||.:..       :.::...|...
Mouse   200 NKPIPSLRVAEEKKKKKKKKGRIKKEESVQA-----KESAVDSSSSG-------VCKATKRPRTA 252

  Fly   264 TNGWAHYVIPMAPKPTPGQNM-------AASLP 289
            :.| :....|.||| .|.:..       |:|||
Mouse   253 SEG-SEAETPEAPK-QPAKKKKKRDKVEASSLP 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621
RRM2_hnRNPA_like 137..209 CDD:240774 18/66 (27%)
Larp7NP_613059.2 LARP_7 25..105 CDD:153401
RRM1_LARP7 120..199 CDD:240736 18/64 (28%)
RRM_3 442..540 CDD:285930
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0118
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.