DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbp4 and EIF4B

Sequence 1:NP_476935.1 Gene:Rbp4 FlyBaseID:FBgn0010258 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001287750.1 Gene:EIF4B HGNCID:3285 Length:616 Species:Homo sapiens

Alignment Length:417 Identity:82/418 (20%)
Similarity:132/418 (32%) Gaps:143/418 (34%)


  Fly    35 FIGGLSTQTTVETLRGFFSQFGIVADAVVL-RDPVSNHSR--GFGFVTYVDPKSVEIVQRARPHT 96
            |:|.|....|.|:::.||.  |:...||.| |:| ||..|  |||:..:.|..|:.........:
Human    99 FLGNLPYDVTEESIKEFFR--GLNISAVRLPREP-SNPERLKGFGYAEFEDLDSLLSALSLNEES 160

  Fly    97 IDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSK-------RIFLGGLKEY----HDEN 150
            :.|:.:....|...||..|..      .|||.:....:.|       |.......:|    .|::
Human   161 LGNRRIRVDVADQAQDKDRDD------RSFGRDRNR
DSDKTDTDWRARPATDSFDDYPPRRGDDS 219

  Fly   151 IVREYFSQF---------------GPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHW 200
            ...:|..::               ||    :..|||..||.|      :.|              
Human   220 FGDKYRDRYDSDRYRDGYRDGYRDGP----RRDMDRYGGRDR------YDD-------------- 260

  Fly   201 ILQTLVEVKRSTQKADRRFRFPIFSSVRA---GYIPPQPATADSYNYNNPNY------------- 249
                     |.::..||.:...|.|..||   ||     ...|.|......|             
Human   261 ---------RGSRDYDRGYDSRIGSGRRAFGSGY-----RRDDDYRGGGDRYEDRYDRRDDRSWS 311

  Fly   250 -------NPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWS 307
                   :.|......||.       ...:.:.|:.||.::.:::..||.....|:.|....:.:
Human   312 SRDDYSRDDYRRDDRGPPQ-------RPKLNLKPRSTPKEDDSSASTSQSTRAASIFGGAKPVDT 369

  Fly   308 SYPKTGI----YSAQE---------------------WTSSKVAE-WGPKAGHKHAQT---STND 343
            :..:..:    ...||                     |.|.:..| ...:.|.:.:||   :|:.
Human   370 AAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRTGSESSQTGTSTTSS 434

  Fly   344 RAKIDL--------KELQAATFNNKLD 362
            |:|.|.        |.|:..|.|.:.|
Human   435 RSKSDQDARRRESEKSLENETLNKEED 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbp4NP_476935.1 RRM_SF 33..110 CDD:302621 23/78 (29%)
RRM2_hnRNPA_like 137..209 CDD:240774 13/91 (14%)
EIF4BNP_001287750.1 RRM <83..>190 CDD:223796 29/100 (29%)
RRM_eIF4B 95..171 CDD:240848 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0118
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.