DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT5G10350

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_196597.1 Gene:AT5G10350 / 830899 AraportID:AT5G10350 Length:217 Species:Arabidopsis thaliana


Alignment Length:98 Identity:25/98 - (25%)
Similarity:52/98 - (53%) Gaps:4/98 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GSTNGSSDNQSAASGQRD-DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGF 99
            |:|...:...:...|:.: |.|.::||.:.:..|.:|::.||...|.:..:.:..| :.|:.:||
plant    68 GATQDPASMAANQEGKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMD-KFGQPKGF 131

  Fly   100 AFIVFTNTEAIDKVSAADEHIINSK--KVDPKK 130
            |::.|...||:.:....:|..::.:  ||.||:
plant   132 AYVEFVEVEAVQEALQLNESELHGRQLKVSPKR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 18/72 (25%)
RRM2_hnRNPD_like 137..211 CDD:240775
AT5G10350NP_196597.1 PIN_SF <6..70 CDD:475124 1/1 (100%)
RRM_II_PABPs 90..161 CDD:409747 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.