DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and AT3G46020

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_190188.1 Gene:AT3G46020 / 823745 AraportID:AT3G46020 Length:102 Species:Arabidopsis thaliana


Alignment Length:77 Identity:28/77 - (36%)
Similarity:40/77 - (51%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 AKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLK 195
            ||....::||..|:...:|:.::..|..||.|.|..:..|.:..:.|||.|||||||......||
plant     2 AKRISAQLFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALK 66

  Fly   196 TPKQKIAGKEVD 207
            :    :.||.||
plant    67 S----LDGKIVD 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763
RRM2_hnRNPD_like 137..211 CDD:240775 26/71 (37%)
AT3G46020NP_190188.1 RRM 9..88 CDD:440488 26/70 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.