DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and RBMY1A1

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_005049.1 Gene:RBMY1A1 / 5940 HGNCID:9912 Length:496 Species:Homo sapiens


Alignment Length:136 Identity:48/136 - (35%)
Similarity:70/136 - (51%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 KARH-GKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLK 195
            :|.| ||:|:|||..|.:::.:|..||:.|.|.||.:..|: .|:.:||.||||::.....:..|
Human     3 EADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDR-TSKSRGFAFITFENPADAKNAAK 66

  Fly   196 TPKQK-IAGKEVDVKRATPKPENQMMGGMR--------GGPRGGMRGGRGGYGGRGGYNNQWDGQ 251
            ....| :.||.:.|::| .||..| .||.|        ..|.|.:|..||..||..|:....:|.
Human    67 DMNGKSLHGKAIKVEQA-KKPSFQ-SGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSHEGH 129

  Fly   252 GSYGGY 257
            ...|||
Human   130 LDDGGY 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763
RRM2_hnRNPD_like 137..211 CDD:240775 26/74 (35%)
RBMY1A1NP_005049.1 RRM_RBMX_like 7..85 CDD:409816 28/79 (35%)
ELAV_HUD_SF <10..>182 CDD:273741 44/129 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..349 20/60 (33%)
dnaA 158..>316 CDD:455861
RBM1CTR 174..218 CDD:400429
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 452..496
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.