DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and CG11454

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster


Alignment Length:84 Identity:26/84 - (30%)
Similarity:39/84 - (46%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SENGDAGAAGSTNGSSDNQSAASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDP 91
            :||||. ..|......|.:     :.::.|.||.|.|....||:.|.:.|.:.|.||.:.:.|| 
  Fly    47 NENGDQ-LVGQLEDDDDEE-----EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTD- 104

  Fly    92 QTGRSRGFAFIVFTNTEAI 110
            ..||.|.|.|:.:....|:
  Fly   105 NNGRPRNFGFVTYQRLCAV 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 19/53 (36%)
RRM2_hnRNPD_like 137..211 CDD:240775
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.