DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqd and T08B6.1

DIOPT Version :10

Sequence 1:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_500665.2 Gene:T08B6.1 / 188275 WormBaseID:WBGene00020351 Length:96 Species:Caenorhabditis elegans


Alignment Length:80 Identity:18/80 - (22%)
Similarity:31/80 - (38%) Gaps:16/80 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKV 113
            ||.:..:||:.|      ||::..:..|||.....| .....|:.|:.  ...:.:.|..     
 Worm    32 SGFKFRNRKVTV------TTKRTNKPGFGKTTASRS-QCHAKPRPGQR--VTIVKYVNVN----- 82

  Fly   114 SAADEHIINSKKVDP 128
              |..::..||:..|
 Worm    83 --ATVNVFKSKRSAP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763 14/71 (20%)
RRM2_hnRNPD_like 137..211 CDD:240775
T08B6.1NP_500665.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.