DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sqd and R05D3.8

Sequence 1:NP_731825.1 Gene:sqd FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_498843.3 Gene:R05D3.8 WormBaseID:WBGene00019881 Length:311 Species:Caenorhabditis elegans

Alignment Length:247 Identity:50/248 (20%)
Similarity:89/248 (36%) Gaps:87/248 (35%)


  Fly    56 RKLFVGGLSWETTEKELRDHFGKYGEI--------------------ESINVKT----------- 89
            :::||.||...|||..::.:|.::|.:                    |.|:.::           
 Worm     3 KRIFVQGLDSYTTESTVKKYFEQFGTLYECILPPPPRYSVFDNGPDEEKISTRSSIRYEPVENDD 67

  Fly    90 ----------------------------------DPQTGRSRGFAFIVFTNTEAIDKVSAADEHI 120
                                              :|:. .|.|:|:|.|.::........:|.|.
 Worm    68 VLDDELDVERYDVEKHGDFESYMKKIGEGEAFIKEPRK-TSAGYAYITFVDSNGYSNCMKSDIHE 131

  Fly   121 INSKK--VDP------KKAKARHGKIFVGGLTTE-ISDEEIKTYFGQFGNIVEVEMPFDKQKSQR 176
            |:..|  |:|      ||.|....::||.....: ::.:|:|..||.:|.|.:||...|.:....
 Worm   132 IDRAKCTVEPAKDENDKKLKVESKRLFVSYFPLDRLTSKELKMNFGAYGKITDVEFVSDSEGPLH 196

  Fly   177 KGFCFITF-DSEQV---------VTDLLKTPKQKIAGKEVDVKRATPKPENQ 218
              ||.||| ||..|         :.|:|...::.:..:.|.:.....|.:.|
 Worm   197 --FCIITFADSRSVDVLLTKSIYIRDVLMFTRRAVLKESVKIAEHKIKEQEQ 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 23/144 (16%)
RRM2_hnRNPD_like 137..211 CDD:240775 22/85 (26%)
R05D3.8NP_498843.3 RRM_SF 4..>34 CDD:302621 9/30 (30%)
RRM_SF 155..>209 CDD:302621 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.