DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and YBR053C

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_009609.1 Gene:YBR053C / 852342 SGDID:S000000257 Length:358 Species:Saccharomyces cerevisiae

Alignment Length:114 Identity:24/114 - (21%)
Similarity:39/114 - (34%) Gaps:46/114 - (40%)


  Fly   171 QVMVFDLATDQLIHRYRLPETSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYD 235
            :|.:|||...:|:..:.|||.:.:.....||.              ||:|.     |:....:.|
Yeast   278 KVQMFDLTNGKLLKEFILPEQTPRVSCCCFVG--------------KDLFV-----TTANAEIND 323

  Fly   236 VV-------GQSSWRIENKFTYPDAKFGTHTVAGESFELLDGPLALATT 277
            .|       |...::|.|                    :|||.:.|.:|
Yeast   324 AVRTNTDKNGGCIYKIPN--------------------VLDGNVPLEST 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 24/114 (21%)
YBR053CNP_009609.1 YvrE 1..345 CDD:225921 20/105 (19%)
WD40 repeat 150..186 CDD:293791
WD40 repeat 199..248 CDD:293791
WD40 repeat 259..294 CDD:293791 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.