DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and rgn

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001006822.1 Gene:rgn / 448549 XenbaseID:XB-GENE-483637 Length:299 Species:Xenopus tropicalis

Alignment Length:112 Identity:25/112 - (22%)
Similarity:41/112 - (36%) Gaps:35/112 - (31%)


  Fly   113 VQRENGSEIQAYPSYQWHSSHGANCDGLTSVYRVHID----ACGQMWVLDSGEIEFVQHCAPQV- 172
            |:|..||....||.:              ||.: |.|    :.|..|.||...:.::...:.:| 
 Frog   127 VERNQGSLFTLYPDH--------------SVVK-HFDMVDISNGLDWSLDHKTLYYIDSLSFKVD 176

  Fly   173 -MVFDLATDQLIHRYRLPETSYKAKVSRFVNIFADIRDPPPSGQCKD 218
             :.:|:.|.:..:|    .|.||.:....:          |.|.|.|
 Frog   177 ALDYDMKTGKSSNR----RTLYKLQQDEGI----------PDGMCID 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 19/84 (23%)
rgnNP_001006822.1 SGL 17..263 CDD:312077 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.