DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and yellow-h

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_651912.3 Gene:yellow-h / 43779 FlyBaseID:FBgn0039896 Length:463 Species:Drosophila melanogaster

Alignment Length:440 Identity:132/440 - (30%)
Similarity:221/440 - (50%) Gaps:46/440 - (10%)


  Fly    22 LNPPKTIFPDFKFPSDYRDT--------------PIVFEWKNLQYGFPSEQERDQVLRNGRYNPD 72
            ||...::.|.|:....|..|              .||:|||.|.:.:.:..:|.|.:.||.:.|.
  Fly    20 LNGNLSVQPVFQTLDGYEYTSQSFSQNLQSESQLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPK 84

  Fly    73 SPIPIDIDVYYPPNGGPPRHFVTSPRFGQGVPFSLGYVTNVQRENGSEIQAYPSYQWHSS-HGAN 136
            :.:|:.|||:   |.   |.|||:||:..|||.|||.:....:|:...|:.||:::.|.: :..:
  Fly    85 NNLPLGIDVH---NN---RLFVTTPRWKNGVPASLGTLPFPPKESSPAIKPYPNWEAHGNPNNPD 143

  Fly   137 CDGLTSVYRVHIDACGQMWVLDSG----EIEFVQHCAPQVMVFDLATDQLIHRYRLPETSYKAKV 197
            |..|.||||..:|.|.::|::|||    .|...|.|.|:::|:||.:|:||.||.| |.|:..:.
  Fly   144 CSKLMSVYRTAVDRCDRIWLIDSGIVNATINLNQICPPKIVVYDLKSDELIVRYNL-EASHVKQD 207

  Fly   198 SRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQSSWRIENKFTYPDAKFGTHTVAG 262
            |...||..||.:     .|.|..|.::|.....::||.:....|||:.|...|||.......|.|
  Fly   208 SLHSNIVVDIGE-----DCDDAHAIVSDVWRFGLLVYSLSKNRSWRVTNYNFYPDPFASDFNVYG 267

  Fly   263 ESFELLDGPLALATTPLGLGLRRHLIFHALSNELELAIPLDILNNATNWQKGLSSSLSEFTVLGK 327
            .:|:.|||...::.......:.|.|.||.:::..|..:|::||.|.:.||.........|..:|.
  Fly   268 LNFQWLDGVFGMSIYYNKKIMERVLYFHPMASFKEFMVPMNILLNESVWQTNTQEYAKYFIPIGD 332

  Fly   328 RGI--QCASHAISRQGFLFCGFLEPIGIFGWDIRRPYNR------ENVKLLAINPATLQFVSGMK 384
            ||.  |.::..::|.|.:|...:....|..||..:||.|      .|::    |...:||.:.:|
  Fly   333 RGYNSQSSTSGVTRNGIMFFTQVHQDDIGCWDTSKPYTRAHLGKFHNME----NSNLIQFPNDLK 393

  Fly   385 IVRRPADGREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGRGC 434
            :.:   :..:.:||:|:||.......:||.|:|:|:::.:|:.:::...|
  Fly   394 VDK---EKDQNVWLISNRLPIFLYSNLDYGEVNFRILKANVNKIIRNSVC 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 90/304 (30%)
yellow-hNP_651912.3 MRJP 148..440 CDD:281074 90/304 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134614984
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.