DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and yellow-e

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_524344.1 Gene:yellow-e / 41653 FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster

Alignment Length:405 Identity:103/405 - (25%)
Similarity:185/405 - (45%) Gaps:56/405 - (13%)


  Fly    41 TP---IVFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPN-------GGPPRHFVT 95
            ||   :..:||.|:|.|               .|.:|:. |.:.|.|.|       ....|.||.
  Fly    22 TPGLQVAKQWKLLRYNF---------------EPQAPVS-DPNFYNPQNVLITGLAVTDDRIFVA 70

  Fly    96 SPRFGQGVPFSLGYVTNVQRENGSEIQAYPSYQWHSSHGA--NCDG--LTSVYRVHIDACGQMWV 156
            :|:...|||.::.:|:..|..:...:.|:|.:.:.::..:  ||..  ||||||:.:|:|.::|:
  Fly    71 TPKLFSGVPSTVSWVSKAQFGDSPTLNAFPDWTFSNTGRSDFNCSDLILTSVYRLRVDSCNRIWL 135

  Fly   157 LDSGEIEFVQH----CAPQVMVFDLATDQLIHRYRLPETSYKAKVSRFVNIFADIRDPPPSGQCK 217
            ||:|....::.    |.|:::|.|||||:::.|...|....:.: |.|.|:   :.|...:..|.
  Fly   136 LDAGISRSLEDYEITCPPKILVVDLATDRVVRRIDFPPEVLRGE-SLFTNM---VIDETTAKGCD 196

  Fly   218 DVFAYLADPTSKAIVVYDVVGQSSWRIENKFTYPDAKFGTHTVAGESFELLDGPLALATTPLGLG 282
            |||.|:.|.....|:|||.....:||:.:...|||..|....:....|.|:||.:.| |.....|
  Fly   197 DVFVYITDTVEPGIIVYDSGKDVTWRVSHPAMYPDPDFAQSEIHEHRFVLMDGVVGL-TFDERTG 260

  Fly   283 LRRHLIFHALSNELELAIPLDILNNATNWQKGLSSSLSEFTVLGKRGIQCASHAISR-QGFLFCG 346
            :   :.|..|:.:...::..::| .|.....|   .:.:..::||:..|....|:|. ...|...
  Fly   261 V---VYFQPLATDRVFSVHKNVL-RAGPLPDG---KMLDVKLVGKKSSQGIGLAVSPFDSSLIFS 318

  Fly   347 FLEPIGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVR-RPADGREELWLLSDRLQKIFAGT 410
            .|....|..|:  ...|:::|  ||.:...||||:.:...: .|.    .::.::.:..:.|...
  Fly   319 PLSETAIASWN--PTTNQQSV--LAFDRDQLQFVADITTTKSEPG----VIYAIASKFHRFFLKN 375

  Fly   411 IDYREINYRVMRCDV 425
            ::..|.|.|::|.::
  Fly   376 LNPNEFNNRIVRLEL 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 76/291 (26%)
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 76/291 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615601
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.