DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and yellow-f2

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_650247.1 Gene:yellow-f2 / 41596 FlyBaseID:FBgn0038105 Length:452 Species:Drosophila melanogaster

Alignment Length:431 Identity:116/432 (27%)
Similarity:194/432 (45%) Gaps:59/432 (14%)


  Fly    30 PDFK----FPSDY----------RDTPIVFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDID 80
            |.|.    ||..|          ||||:|..         |..:.|.  .|..|.|.:.:|:...
  Fly    54 PSFSAPVVFPGKYSRRKRKIMTSRDTPVVVS---------SRADSDD--PNASYIPYNNVPMGAT 107

  Fly    81 VYYPPNGGPPRHFVTSPRFGQGVPFSLGYVTNVQRENGS----EIQAYPSYQWHSSHGANCDGLT 141
            .:   .|   |.|||.||...|:|.:|.|:.  ..|:||    :::|||::.. :...|:.:.|.
  Fly   108 HF---RG---RLFVTMPRRRVGIPSTLNYID--LAEDGSNRSPKLRAYPNFAL-NQFNASAENLV 163

  Fly   142 SVYRVHIDACGQMWVLDSGEIEF----VQHCAPQVMVFDLATDQLIHRYRLPETSYKAKVSR-FV 201
            ||||..:|||.::|.:|:|.:|:    .|...|.:.|.||||||::.|:.:||:.  |:..| ..
  Fly   164 SVYRTSVDACQRLWFIDTGMLEYPNNRQQIRRPSIWVVDLATDQVLKRFDVPESI--AETGRGLA 226

  Fly   202 NIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQSSWRIENKFTYPDAKFGTHTVAGESFE 266
            :|..|::    :|||.|.:||:.|...:.:.||.:.....|..|:.:...|...|..::.|::|.
  Fly   227 SITVDVK----AGQCGDAYAYIPDLVYRRLYVYHLRNDRIWSFEHNYFNFDPLSGDLSIGGQTFR 287

  Fly   267 LLDGPLALATTPLGLGLRRHLIFHALSNELELAIPLDILNNATNWQKGLSSSLSEFTVLGKRG-- 329
            ..||..::......|...|...||.:::..|..:...:|...:|..:  |...::|.|||.||  
  Fly   288 WDDGIFSITLGAQKLDGSRDAYFHPMASTNEFVVSNRVLQQESNAAR--SDHGNDFRVLGSRGPS 350

  Fly   330 IQCASHAIS-RQGFLFCGFLEPIGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVRRPADGR 393
            .|...||.. ..|.:|...::..|:..|...:|.:.||...:..|...:.:.|.:.|   ..|| 
  Fly   351 TQSTMHAYDPGTGVIFFDEIQRNGVGCWKTSKPISAENYGSVDSNAEDMIYPSDLSI---DEDG- 411

  Fly   394 EELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGRGC 434
             .:|::|:.:......|:|....|:|:.:.......:|..|
  Fly   412 -TIWVMSNSMPIFIYSTLDTSIYNFRIWKQKASLAKRGTVC 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 80/301 (27%)
yellow-f2NP_650247.1 MRJP 163..451 CDD:281074 80/301 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615354
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.