| Sequence 1: | NP_650289.2 | Gene: | yellow-e2 / 41652 | FlyBaseID: | FBgn0038151 | Length: | 435 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650247.1 | Gene: | yellow-f2 / 41596 | FlyBaseID: | FBgn0038105 | Length: | 452 | Species: | Drosophila melanogaster | 
| Alignment Length: | 431 | Identity: | 116/431 - (26%) | 
|---|---|---|---|
| Similarity: | 194/431 - (45%) | Gaps: | 59/431 - (13%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    30 PDFK----FPSDY----------RDTPIVFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDID 80 
  Fly    81 VYYPPNGGPPRHFVTSPRFGQGVPFSLGYVTNVQRENGS----EIQAYPSYQWHSSHGANCDGLT 141 
  Fly   142 SVYRVHIDACGQMWVLDSGEIEF----VQHCAPQVMVFDLATDQLIHRYRLPETSYKAKVSR-FV 201 
  Fly   202 NIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQSSWRIENKFTYPDAKFGTHTVAGESFE 266 
  Fly   267 LLDGPLALATTPLGLGLRRHLIFHALSNELELAIPLDILNNATNWQKGLSSSLSEFTVLGKRG-- 329 
  Fly   330 IQCASHAIS-RQGFLFCGFLEPIGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVRRPADGR 393 
  Fly   394 EELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGRGC 434 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| yellow-e2 | NP_650289.2 | MRJP | 141..434 | CDD:281074 | 80/300 (27%) | 
| yellow-f2 | NP_650247.1 | MRJP | 163..451 | CDD:281074 | 80/300 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45449232 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG3386 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D940689at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR10009 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.850 | |||||