DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and yellow-f

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster

Alignment Length:432 Identity:111/432 - (25%)
Similarity:193/432 - (44%) Gaps:77/432 - (17%)


  Fly    44 VFEWKNLQY-----GFPSEQER----DQVLRNGR-------------YNPDSPIPIDIDVYYPPN 86
            ||:||.|.:     |:.....|    |....|.|             ||   .:|..:..:   .
  Fly    29 VFKWKQLDFYNRGDGYKDLWNRICIPDSHFYNSRKCLGSSSSGSFIQYN---NVPQGVTHF---R 87

  Fly    87 GGPPRHFVTSPRFGQGVPFSLGYVTNVQRENGSE---IQAYPSY---QWHSSHGANCDGLTSVYR 145
            |   |.|||.||...|:|.:|.|: ::.::..|:   ::|||:.   |:::|.    ..|.||||
  Fly    88 G---RLFVTVPRRQPGIPSTLNYI-DLAKDGWSQSPHLRAYPNLAVNQYNASE----QNLVSVYR 144

  Fly   146 VHIDACGQMWVLDSGEIEF------VQHCAPQVMVFDLATDQLIHRYRLPETSYKAKVSR-FVNI 203
            ..:|.||::|.:|:|.:||      ::|  |.:.|.|||.|:|:.|:.:|::.  .::.| ..:|
  Fly   145 TSVDVCGRLWFVDTGMLEFPNNRQQIRH--PSIWVIDLANDRLLKRFEIPQSI--VEIGRGLASI 205

  Fly   204 FADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQSSWRIENKFTYPDAKFGTHTVAGESFELL 268
            ..|:    .:.:|.|.:||:.|..::.:.||.:.....|..|:.|...|.......:.|::|...
  Fly   206 TIDV----GARRCNDAYAYIPDLVNRRLHVYHLRSDRIWSFEHSFFNFDPLSDNLNIGGQTFRWD 266

  Fly   269 DGPLALAT----TPLGLGLRRHLIFHALSNELELAIPLDILNNATNWQKGLSSSLSEFTVLGKRG 329
            || :..||    .|.|   .|.:.||.:::..|..:...:|....|..:  |....:|.:||.||
  Fly   267 DG-IFSATLGSYKPDG---SRDVFFHPMASTNEFVVSNRVLQQEFNAAR--SDHGDDFHLLGTRG 325

  Fly   330 --IQCASHAIS-RQGFLFCGFLEPIGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVRRPAD 391
              .|...|... |.|.:|...::..|:..|...:|::.||...:..|.:.:.:.|.:.|     |
  Fly   326 PSTQSTMHKYDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTI-----D 385

  Fly   392 GREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGRG 433
            ....:|::|:.:.......:|..:.|:|:.|  ...||..||
  Fly   386 EEGYIWVMSNSMPIFVYSKLDVEKYNFRIWR--QSTLLAKRG 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 80/307 (26%)
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 80/307 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615271
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.