DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and rgn

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_991309.1 Gene:rgn / 403070 ZFINID:ZDB-GENE-040718-68 Length:295 Species:Danio rerio

Alignment Length:76 Identity:20/77 (26%)
Similarity:29/77 (38%) Gaps:17/77 (22%)


  Fly   145 RVHIDACGQMWVLDSGEIEFVQHCAPQVMVF--DLATDQLIHRYRLPETSYKAKVSRFVNIFADI 207
            :||: :.|..|.||.....::...|..|..|  |:.|..|.:|    .|.||.:....:      
Zfish   145 QVHL-SNGLDWSLDHRVFYYIDSLAFMVEAFDYDIQTGGLSNR----RTVYKMEKDEGI------ 198

  Fly   208 RDPPPSGQCKD 218
                |.|.|.|
Zfish   199 ----PDGMCID 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 20/77 (26%)
rgnNP_991309.1 SGL 16..260 CDD:285626 20/77 (26%)
NHL 150..>233 CDD:302697 18/71 (25%)
NHL repeat 150..193 CDD:271320 14/47 (30%)
NHL repeat 199..233 CDD:271320 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.