DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and yellow-g2

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster

Alignment Length:451 Identity:96/452 (21%)
Similarity:160/452 (35%) Gaps:102/452 (23%)


  Fly     2 LILALVVWLAYPNLCL--------AQYHLNPPKTIFPDFKFPSDYRDTPIVFEWKNLQYGFPSEQ 58
            |.|||::     ..||        .:|.|..|.....|        ..||  :|...|:.||...
  Fly     3 LHLALIL-----GFCLVGWARSQGTKYGLWTPDRAHSD--------SQPI--QWTGGQFEFPCAS 52

  Fly    59 ERDQVLRNGRYNPDSPIPIDI----DVYYPPNGGPPRHFVTSPRFGQGVPFSLGYVTNVQRENGS 119
            .:.....:|::.|.:.|....    |..|          :..||:.:|||.:|...:.......:
  Fly    53 TKSLFKSSGKFIPKNVIATRAQLIGDTIY----------LALPRYRKGVPATLVKTSIKPGTCST 107

  Fly   120 EIQAYPSYQWHSSHGANCDGLTSVYRVHIDACGQMWVLDSGEIEF----VQHCAPQVMVFDLATD 180
            ..:.||.  |......||..|.||..:.:|....:||||:|.:..    |:.|.|:|:...:.|.
  Fly   108 TFKPYPC--WDLQEEGNCKALQSVVDLVVDQNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVKTG 170

  Fly   181 QLIHRYRLPE-TSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQSSWRI 244
            :::....|.. ||..:::...|..:|      |.|.|   |.|::|..::||:||::.....:|:
  Fly   171 KVLKTVSLEGLTSSNSRLQYLVVDYA------PDGGC---FVYVSDAANRAIIVYNLQADRGFRV 226

  Fly   245 ENKFTYPDAKFGTHTVAGESFELLDGPLALATTPLGLGLRRHLIFHALSNELELAIPLDILNNAT 309
                ..|.|.    |....|.::|  .:||.....|   ...|.|..||.....::..:.|    
  Fly   227 ----VLPKAV----TAGCRSRDVL--YIALIRRDCG---STELYFTYLSTNKLFSLKSEYL---- 274

  Fly   310 NWQKGLSSSLSEFTVLGKRGIQCASHAISRQGFLFCGFLEPIGIFGWDIRRPYNRENVKLLAINP 374
              :.|::.  .....|||:..:...........:|........::.||....:...|.|      
  Fly   275 --RSGVAD--GRILDLGKKPSRMVIIGTDNGSAIFFRNEGDAEVYRWDTNSTFVEANFK------ 329

  Fly   375 ATLQFVSGMKIVRRPADGREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGR-GC 434
                     .:.|            |...|.:.....||:....||::.:..|.:|.| ||
  Fly   330 ---------PVYR------------SQTCQLVTHAVPDYKRNTMRVLQSNFPDYMQNRVGC 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 62/299 (21%)
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 63/301 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134615864
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.