DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and yellow-g

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster

Alignment Length:259 Identity:72/259 - (27%)
Similarity:114/259 - (44%) Gaps:42/259 - (16%)


  Fly    43 IVFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFGQGVPFSL 107
            :.|:.......:|.|..::..:::|||.|.:.|.....:.      ....||..||:.|||||:|
  Fly    47 LTFQLSGSSLHWPCESTKNIYVQSGRYVPRNVIVTRAQLQ------RDSAFVALPRYKQGVPFTL 105

  Fly   108 GYVTNVQRENGSEIQAYPSYQWHSSHGANCDGLTSVYRVHIDACGQMWVLDSGEI----EFVQHC 168
            |.|...:.|..::|..||.  |......||..|.||..:.:|..|.:|.||.|.:    :.::.|
  Fly   106 GKVNLKKGECLTKIAPYPC--WAIQEEGNCQALQSVVDIAVDQNGLLWALDVGIVNTLEQPIRRC 168

  Fly   169 APQVMVFDLATDQLIHRYRLPE--TSYKAKVSRFVNIFADI-RDPPPSGQCKDVFAYLADPTSKA 230
            :|:::..:.|..:::....|.:  ||    .||...|..|. :|..|       |.|:||..:::
  Fly   169 SPKIVAINTANHKVVKSIDLSDLVTS----ESRLQFIVVDYSKDNKP-------FVYVADAGARS 222

  Fly   231 IVVYDVVGQSSWRIENKFTYPDAKFGTHTVAGESFELLDGPLALATTPLGLGLRRHLIFHALSN 294
            |:|||:.|..|:||    ..|.|...|..|.         .:||.:.|.|...   |.|..||:
  Fly   223 ILVYDITGNKSYRI----VLPKATAPTSDVL---------YVALTSKPDGTST---LFFSYLSS 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 44/161 (27%)
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 44/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134616098
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.