DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and yellow-d

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_523820.2 Gene:yellow-d / 37703 FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster

Alignment Length:434 Identity:175/434 - (40%)
Similarity:257/434 - (59%) Gaps:21/434 - (4%)


  Fly     1 MLILALVVWLAYPNLCLAQYH---LNPPKTIFPDFKFPSDYRDTPIVFEWKNLQYGFPSEQERDQ 62
            |:::.|.:.|...:|.|||.:   :|.|:.:          |....:.:|..|::|||:.|:|:.
  Fly     1 MVMMPLRILLIAFSLTLAQSYGVGVNGPRPV----------RTVETLTQWGQLEFGFPTAQDREN 55

  Fly    63 VLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFGQGVPFSLGYVTNVQRENGSEIQAYPSY 127
            ....|...|::..|||:...|..| |..|.|.|.|||..|:|::|..|:..|..||..:|.||:|
  Fly    56 AQAAGNLVPENGTPIDVQPQYMAN-GQIRLFTTIPRFVTGIPYTLATVSATQGRNGPLLQPYPNY 119

  Fly   128 QWHSSHGANCDGLTSVYRVHIDACGQMWVLDSGEIEFVQHCAPQVMVFDLATDQLIHRYRLPETS 192
            .||:::|.:||.:||.:||.|..|.||||:|||.|...|.|.||::.|.||||:|:||:|.|..:
  Fly   120 SWHNANGEDCDRITSAFRVAITECNQMWVIDSGVIGTTQLCPPQLLQFALATDRLLHRFRFPNDT 184

  Fly   193 YKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQSSWRIENKFTYPDAKFGT 257
            |....|.|:.....::||||.|.|.....|:||.:...:||||...|:|||.||:|.|||..:|.
  Fly   185 YIPSGSLFITPNVLVQDPPPRGTCSRTMIYVADVSYHGLVVYDHQAQTSWRAENRFMYPDPDYGK 249

  Fly   258 HTVAGESFELLDGPLALATTPLGLGLRRHLIFHALSNELELAIPLDILNNATNWQKGLSSSLSEF 322
            ||:|||||.|:||..||...      :|:|.||.|::..|.::||..||...||..|..:...||
  Fly   250 HTIAGESFYLMDGMFALNND------KRNLYFHPLASASEYSVPLSALNRQQNWANGPEALPEEF 308

  Fly   323 TVLGKRGIQCASHAISRQGFLFCGFLEPIGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVR 387
            .:||:|..:||:.||..:..::|....|:.:|.|::..|||..|...|......||||||||::|
  Fly   309 RLLGRRRSECAASAIDGRNNVYCVTFNPVKLFVWNVNSPYNSRNFGNLPAKSDDLQFVSGMKVLR 373

  Fly   388 RPADGREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQG 431
            . .:|:||||:||:|.|||.|||::.:|:|:|::|..:||:..|
  Fly   374 N-REGQEELWMLSNRYQKIAAGTLNSKEVNFRILRRKLDDVQGG 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 128/291 (44%)
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 126/286 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134614499
eggNOG 1 0.900 E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10009
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.