DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-e2 and Rgn

DIOPT Version :8

Sequence 1:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_033086.1 Gene:Rgn / 19733 MGIID:108024 Length:299 Species:Mus musculus

Alignment Length:181 Identity:38/182 (21%)
Similarity:58/182 (32%) Gaps:62/182 (34%)


  Fly    47 WKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFV------TSPRFGQGVPF 105
            |:|......:..:.|:  :|.|:|         |....|.|   |:|.      |:|..      
Mouse    82 WENQSVFVLAMVDEDK--KNNRFN---------DGKVDPAG---RYFAGTMAEETAPAV------ 126

  Fly   106 SLGYVTNVQRENGSEIQAYPSYQWHSSHGANCDGLTSVYRVHID-ACGQMWVLDSGEIEFVQHCA 169
                   ::|..||....:|.   ||         ...|...:| :.|..|.||.....::...:
Mouse   127 -------LERHQGSLYSLFPD---HS---------VKKYFDQVDISNGLDWSLDHKIFYYIDSLS 172

  Fly   170 PQVMVF--DLATDQLIHRYRLPETSYKAKVSRFVNIFADIRDPPPSGQCKD 218
            ..|..|  ||.|.|:.:|    ...||.:....:          |.|.|.|
Mouse   173 YTVDAFDYDLQTGQISNR----RIVYKMEKDEQI----------PDGMCID 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 19/82 (23%)
RgnNP_033086.1 SGL 16..264 CDD:285626 38/182 (21%)
NHL 166..>237 CDD:302697 13/59 (22%)
NHL repeat 203..237 CDD:271320 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.