DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and JEM1

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_012462.3 Gene:JEM1 / 853372 SGDID:S000003609 Length:645 Species:Saccharomyces cerevisiae


Alignment Length:103 Identity:43/103 - (41%)
Similarity:54/103 - (52%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDK---NPNE-----GEKFKAISQAYEVLSDADKRQV 63
            ||.||||.|:|:..|::|||..|..||||||   |.|:     .|....|::|||.|||.|||:.
Yeast   539 YYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDDKRKE 603

  Fly    64 YD----EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGF 97
            ||    ........:|...:..|:||...|.  ||.||
Yeast   604 YDLSRSNPRRNTFPQGPRQNNMFKNPGSGFP--FGNGF 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 43/103 (42%)
DnaJ 7..65 CDD:278647 32/65 (49%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
JEM1NP_012462.3 DnaJ 536..>644 CDD:223560 43/103 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.