DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and CWC23

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_011387.2 Gene:CWC23 SGDID:S000003096 Length:283 Species:Saccharomyces cerevisiae

Alignment Length:71 Identity:29/72 (40%)
Similarity:39/72 (54%) Gaps:16/72 (22%)


  Fly     8 YDILGVKPNATP----------DELKKAYRKLALKYHPDK---NPNEGEKFKAISQAYEVLSDAD 59
            ||:|.:   .||          .::|:.||.|||||||||   ||:...||..:|.|..:|::||
Yeast    17 YDVLEL---PTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIHKFHLLSTATNILTNAD 78

  Fly    60 KRQVYD 65
            .|..||
Yeast    79 VRPHYD 84

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 29/72 (40%)
DnaJ 7..65 CDD:278647 28/70 (40%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
CWC23NP_011387.2 CbpA 14..228 CDD:225124 29/72 (40%)
DnaJ 15..84 CDD:306689 28/70 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.