DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and Dnaja2

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_114468.2 Gene:Dnaja2 RGDID:71001 Length:412 Species:Rattus norvegicus

Alignment Length:410 Identity:201/411 (49%)
Similarity:264/411 (64%) Gaps:18/411 (4%)


  Fly     2 VKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDE 66
            |.:|..||||||.|.|:.:||||||||||.:||||||||.|:|||.||.||||||:.:||::||.
  Rat     4 VADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDR 68

  Fly    67 GGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGRRR----ERRGKDVVHQMSVQLEELYNG 127
            .||..:::|....|...   |.|...||.|..|..|.:.|    .|||:|::|.:.|.||:||||
  Rat    69 YGEQGLREGSGGGGGMD---DIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNG 130

  Fly   128 ATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGET 192
            .|.||||.|||:|..|.|:|||.|:::||..|||.||...::|:|||::|.::.||..|:|.||.
  Rat   131 KTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEV 195

  Fly   193 IQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTF 257
            |.||||||.|.|:|.::|.|:||||::|||:.||:|.||||.|..|..:||||::||.||||..|
  Rat   196 INEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVF 260

  Fly   258 AHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPME 322
            ...|.||.|...:.|||||||||...|.||.|.::|...||:||.....:.:..||||.::||.|
  Rat   261 QRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFE 325

  Fly   323 KGTLIIQFEVIFPE--VINPSVVPTLKQCLPPAPEVDIPI-DAEQTVLEDFDPK------QRRQQ 378
            ||.|.|:|:|.|||  .|||..:..|:..||..|||...| :.|:..|::||..      |||:.
  Rat   326 KGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPEVPNVIGETEEVELQEFDSTRGSGGGQRREA 390

  Fly   379 HQRMAYDEDDGGYQDGPRVQ 398
            :...: ||:...:. ||.||
  Rat   391 YNDSS-DEESSSHH-GPGVQ 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 200/409 (49%)
DnaJ 7..65 CDD:278647 41/58 (71%)
DnaJ_C 112..336 CDD:199909 118/224 (53%)
DnaJ_zf 140..206 CDD:199908 34/66 (52%)
Dnaja2NP_114468.2 PTZ00037 4..412 CDD:240236 201/411 (49%)
CXXCXGXG motif 143..150 3/7 (43%)
CXXCXGXG motif 159..166 4/7 (57%)
CXXCXGXG motif 186..193 3/7 (43%)
CXXCXGXG motif 202..209 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012379at2759
OrthoFinder 1 1.000 FOG0000456
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126883
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.