DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and AT5G25530

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_197935.1 Gene:AT5G25530 AraportID:AT5G25530 Length:347 Species:Arabidopsis thaliana

Alignment Length:405 Identity:123/406 (30%)
Similarity:174/406 (43%) Gaps:125/406 (31%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPN---EGE-KFKAISQAYE--------VLSDAD 59
            |||||.|..|||.|:|||:|||||:|:|||||||   |.| |||.||:|||        ||||..
plant     5 YYDILKVNRNATEDDLKKSYRKLAMKWHPDKNPNTKTEAEAKFKQISEAYEAKYEVMFQVLSDPQ 69

  Fly    60 KRQVYDEGGEAAI----------KKGGADSGDFRNPMDFFEKFFGA---GFGGSGGGRRRERRGK 111
            ||.|||:.||..:          ..|.|...:.||..|.|.:|||:   |||.:||..|..|...
plant    70 KRAVYDQYGEEGLSDMPPPGSTGNNGRAGGFNPRNAEDIFAEFFGSSPFGFGSAGGPGRSMRFQS 134

  Fly   112 D------------------------------------VVHQMSVQLEELYNGATRKLQLQKNVIC 140
            |                                    |..::...|||||:|:|||:::.:::: 
plant   135 DGGGGMFGGFGGGNNGSENNIFRTYSEGTPAPKKPPPVESKLPCSLEELYSGSTRKMKISRSIV- 198

  Fly   141 DKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGR 205
                                                                        :.:||
plant   199 ------------------------------------------------------------DANGR 203

  Fly   206 KTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPL 270
            : .:|.::|.:.::.|.:.|.||.|..:|:.:....|.|::.::|||.|..|...|.||:....:
plant   204 Q-AQETEILTIVVKPGWKKGTKIKFPDKGNEQVNQLPADLVFVIDEKPHDLFTRDGNDLITSRRV 267

  Fly   271 QLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFP 335
            .|.||:.|....:.|||.|:|.|..  .|::.......:..|||||.|.|..||.|.|:|:|.||
plant   268 TLAEAIGGTTVNINTLDGRNLPVGV--AEIVSPGYEFVVPGEGMPIAKEPRNKGDLKIKFDVQFP 330

  Fly   336 EVINPSVVPTLKQCL 350
            ..:.......||:.|
plant   331 ARLTTEQKSALKRVL 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 123/406 (30%)
DnaJ 7..65 CDD:278647 44/70 (63%)
DnaJ_C 112..336 CDD:199909 57/260 (22%)
DnaJ_zf 140..206 CDD:199908 2/66 (3%)
AT5G25530NP_197935.1 DnaJ 1..342 CDD:223560 121/401 (30%)
DnaJ 4..75 CDD:278647 44/70 (63%)
DnaJ_C 170..333 CDD:199909 56/227 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.