DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and J3

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_189997.1 Gene:J3 AraportID:AT3G44110 Length:420 Species:Arabidopsis thaliana

Alignment Length:408 Identity:189/409 (46%)
Similarity:268/409 (66%) Gaps:18/409 (4%)


  Fly     5 TGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            |.:|:||||..:|:|::|||||:|.|:|.||||. .:.||||.::||||||||.:||::||:.||
plant    13 TKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKG-GDPEKFKELAQAYEVLSDPEKREIYDQYGE 76

  Fly    70 AAIKKGGADSGDFRNPMDFFEKFFGAG-FGGSGGGRRRERRGKDVVHQMSVQLEELYNGATRKLQ 133
            .|:|:|....|...:|.|.|..|||.| |||:...:||:|||:||||.:.|.||::|.|..:||.
plant    77 DALKEGMGGGGGGHDPFDIFSSFFGGGPFGGNTSRQRRQRRGEDVVHPLKVSLEDVYLGTMKKLS 141

  Fly   134 LQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDR 198
            |.:|.:|.||.|:|.|.|:..||..|:|:|::..::|:.||::|.::..|.:|.||||||.::||
plant   142 LSRNALCSKCNGKGSKSGASLKCGGCQGSGMKVSIRQLGPGMIQQMQHACNECKGTGETINDRDR 206

  Fly   199 CKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQD 263
            |..|.|.|.:.|:|||||::||||:..|||.|.|:.|..|::..|||:.:|.:|||..|...|:|
plant   207 CPQCKGDKVIPEKKVLEVNVEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGED 271

  Fly   264 LMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLII 328
            |.::..|.|.|||||||.::..||.|.|::.:.||||::.:..|.|::|||||::.|..||.|.|
plant   272 LFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYI 336

  Fly   329 QFEVIFPEVINPSVVPTLKQCLP---PAPEVDIPID-AEQTVLEDF---DPKQRRQQHQRMAYDE 386
            .|.|.||:.::|.....|:..||   .|...|:.|| .|:|.|.|.   |..:|:.|.||.|||:
plant   337 HFTVEFPDSLSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDD 401

  Fly   387 DD------GGYQDGPRVQ 398
            ||      ||.|   |||
plant   402 DDEDDDHPGGAQ---RVQ 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 188/407 (46%)
DnaJ 7..65 CDD:278647 34/58 (59%)
DnaJ_C 112..336 CDD:199909 104/224 (46%)
DnaJ_zf 140..206 CDD:199908 29/66 (44%)
J3NP_189997.1 PTZ00037 7..420 CDD:240236 189/409 (46%)
DnaJ 15..72 CDD:278647 34/58 (59%)
DnaJ_C 119..346 CDD:199909 104/227 (46%)
DnaJ_zf 148..214 CDD:199908 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 378 1.000 Inparanoid score I524
OMA 1 1.010
OrthoDB 1 1.010 D1012379at2759
OrthoInspector 1 1.000 T125257
orthoMCL 1 0.900 OOG5_126883
Panther 1 1.100 O PTHR43888
Phylome 1 0.910 0.857 Consistency score
87.980

Return to query results.
Submit another query.