DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajb14

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001071255.1 Gene:dnajb14 ZFINID:ZDB-GENE-061110-138 Length:380 Species:Danio rerio

Alignment Length:263 Identity:81/264 (31%)
Similarity:110/264 (42%) Gaps:73/264 (28%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYD-EGG 68
            ||::||::.:|:.||||||||:||||:|||||  |...:.||.|..||.|||:.:|::.|| .||
Zfish   112 YYEVLGIRKDASDDELKKAYRQLALKFHPDKNHAPGATDAFKKIGNAYSVLSNPEKKRQYDLSGG 176

  Fly    69 E--AAIKKGGADSGDFR-------NPMDFFEKFFGAGFGGSGG-----------------GRRRE 107
            |  :.......:..||.       .|.|.|..|||..|..|..                 |.|.|
Zfish   177 EEPSTPNYSSHEGFDFHRGFESDITPEDLFNMFFGGSFPSSNSHEFTNGRTYSHHTEETRGERVE 241

  Fly   108 RRGKDVVHQMSVQL---------------------EELYN----GATRKLQLQKNVICD------ 141
            .|| |....|.:||                     ..||:    |.|.|.|.: |:..|      
Zfish   242 ERG-DGGFSMFIQLMPIVVLVLVSILSQLLVSTPPYSLYSRPSTGQTVKRQTE-NLHVDYFVTTD 304

  Fly   142 -KCEGRGGKKGSIEKCLQ------CRGN---GVETRVQQIAPGIMQHIEQVCRKCS-GTGETIQE 195
             |.|.:|.....|||.::      .|.|   ..:|:...:....:...|::.||.. .|.|..:|
Zfish   305 FKSEYKGSALLKIEKSVEEDYVSNVRNNCWKERQTKTDLLYAAKVYRDERLQRKAELMTMENCKE 369

  Fly   196 KDR 198
            .||
Zfish   370 LDR 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 81/264 (31%)
DnaJ 7..65 CDD:278647 33/60 (55%)
DnaJ_C 112..336 CDD:199909 29/130 (22%)
DnaJ_zf 140..206 CDD:199908 18/77 (23%)
dnajb14NP_001071255.1 DnaJ 110..>218 CDD:223560 47/106 (44%)
DnaJ 111..172 CDD:278647 33/60 (55%)
DUF1977 272..372 CDD:286411 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.