DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and Dnajb14

DIOPT Version :9

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001028327.1 Gene:Dnajb14 / 70604 MGIID:1917854 Length:379 Species:Mus musculus


Alignment Length:266 Identity:80/266 - (30%)
Similarity:107/266 - (40%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||::|||..:|..::|||||||||||:|||||  |...:.||.|..||.|||:.:||:.||..|.
Mouse   109 YYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYDLTGS 173

  Fly    70 AAIKKGGADSGDFR---------NPMDFFEKFFGAGF-GGS------------------GGGRRR 106
            ........::|.|.         .|.|.|..|||.|| .||                  ..|..|
Mouse   174 EEQACNHQNNGRFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAAYSHQHQHRHSGHER 238

  Fly   107 ERRGKDVVHQMSVQL---------------------EELY----NGATRKLQLQK-----NVICD 141
            |....|....:.:||                     ..||    :|.|.|:|.:.     .|..|
Mouse   239 EEERADGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGSGQTIKMQTENLGVVYYVSKD 303

  Fly   142 -KCEGRGGKKGSIEKCLQ------CRGNGVETRVQQIAPGIMQHI------EQVCRKCSGTG-ET 192
             |.|.:|.....:||.::      .|.|..:.|.|:..   ||:.      ||:.||..... |.
Mouse   304 FKSEYKGTLLQKVEKSVEEDYVTNIRNNCWKERQQKTD---MQYAAKVYRDEQLRRKADALSMEN 365

  Fly   193 IQEKDR 198
            .:|.:|
Mouse   366 CKELER 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 80/266 (30%)
DnaJ 7..65 CDD:278647 33/59 (56%)
DnaJ_C 112..336 CDD:199909 29/131 (22%)
DnaJ_zf 140..206 CDD:199908 19/73 (26%)
Dnajb14NP_001028327.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..90
DnaJ 107..>214 CDD:223560 46/104 (44%)
DnaJ 108..169 CDD:278647 33/59 (56%)
DUF1977 271..371 CDD:286411 25/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.