DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and Dnajb14

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001028327.1 Gene:Dnajb14 MGIID:1917854 Length:379 Species:Mus musculus

Alignment Length:267 Identity:79/268 (29%)
Similarity:107/268 (40%) Gaps:81/268 (30%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||::|||..:|..::|||||||||||:|||||  |...:.||.|..||.|||:.:||:.||..|.
Mouse   109 YYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYDLTGS 173

  Fly    70 AAIKKGGADSGDFR---------NPMDFFEKFFGAGF-GGS------------------GGGRRR 106
            ........::|.|.         .|.|.|..|||.|| .||                  ..|..|
Mouse   174 EEQACNHQNNGRFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAAYSHQHQHRHSGHER 238

  Fly   107 ERRGKDVVHQMSVQL---------------------EELY----NGATRKLQLQK-----NVICD 141
            |....|....:.:||                     ..||    :|.|.|:|.:.     .|..|
Mouse   239 EEERADGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGSGQTIKMQTENLGVVYYVSKD 303

  Fly   142 -KCEGRGGKKGSIEKCLQ------CRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEK--- 196
             |.|.:|.....:||.::      .|.|..:.|.|:..   ||:..:|.|     .|.::.|   
Mouse   304 FKSEYKGTLLQKVEKSVEEDYVTNIRNNCWKERQQKTD---MQYAAKVYR-----DEQLRRKADA 360

  Fly   197 ---DRCK 200
               :.||
Mouse   361 LSMENCK 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 79/268 (29%)
DnaJ 7..65 CDD:278647 34/60 (57%)
DnaJ_C 112..336 CDD:199909 28/133 (21%)
DnaJ_zf 140..206 CDD:199908 18/75 (24%)
Dnajb14NP_001028327.1 DnaJ 107..>214 CDD:223560 47/105 (45%)
DnaJ 108..169 CDD:278647 34/60 (57%)
DUF1977 271..371 CDD:286411 25/106 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.