| Sequence 1: | NP_650283.1 | Gene: | Droj2 / 41646 | FlyBaseID: | FBgn0038145 | Length: | 403 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001028327.1 | Gene: | Dnajb14 / 70604 | MGIID: | 1917854 | Length: | 379 | Species: | Mus musculus |
| Alignment Length: | 266 | Identity: | 80/266 - (30%) |
|---|---|---|---|
| Similarity: | 107/266 - (40%) | Gaps: | 77/266 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
Fly 70 AAIKKGGADSGDFR---------NPMDFFEKFFGAGF-GGS------------------GGGRRR 106
Fly 107 ERRGKDVVHQMSVQL---------------------EELY----NGATRKLQLQK-----NVICD 141
Fly 142 -KCEGRGGKKGSIEKCLQ------CRGNGVETRVQQIAPGIMQHI------EQVCRKCSGTG-ET 192
Fly 193 IQEKDR 198 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Droj2 | NP_650283.1 | PTZ00037 | 2..398 | CDD:240236 | 80/266 (30%) |
| DnaJ | 7..65 | CDD:278647 | 33/59 (56%) | ||
| DnaJ_C | 112..336 | CDD:199909 | 29/131 (22%) | ||
| DnaJ_zf | 140..206 | CDD:199908 | 19/73 (26%) | ||
| Dnajb14 | NP_001028327.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 56..90 | ||
| DnaJ | 107..>214 | CDD:223560 | 46/104 (44%) | ||
| DnaJ | 108..169 | CDD:278647 | 33/59 (56%) | ||
| DUF1977 | 271..371 | CDD:286411 | 25/102 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||