DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and Dnajb13

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_705755.2 Gene:Dnajb13 MGIID:1916637 Length:316 Species:Mus musculus

Alignment Length:377 Identity:109/378 (29%)
Similarity:166/378 (44%) Gaps:100/378 (26%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.:|.|..|:...::||||||||||.||.|:  |...|.||.|::||:||||..||.:||:.||
Mouse     5 YYAVLQVTRNSEDAQIKKAYRKLALKNHPLKSSEPGAPEIFKQIAEAYDVLSDPVKRGIYDKFGE 69

  Fly    70 AAIKKG-----GADS---------GDFRNPMDFFEKFFGA-----------------GFGGSGGG 103
            ..:|.|     |:.:         |   ||...|.:|||.                 .|||. .|
Mouse    70 EGLKGGIPLEFGSQTPWTTGYVFHG---NPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGL-WG 130

  Fly   104 RRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRV 168
            |..:::...:...:.:.||:|:.|.|:|:::.:.|:                             
Mouse   131 RGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVL----------------------------- 166

  Fly   169 QQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGE 233
                                      .:||..:     |::: |:|.:.:..|.|.|.:|.|..|
Mouse   167 --------------------------NEDRYSS-----TIKD-KILTIDVRPGWRQGTRITFEKE 199

  Fly   234 GDHEPESQPGDIIILLDEKEHSTFAHAGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPG 298
            ||..|...|.|||.::.||.|..|.....:|....|:.|.:||......|||||||  :::....
Mouse   200 GDQGPNIIPADIIFIVKEKLHPRFRREHDNLFFVYPIPLGKALTCCTVEVKTLDDR--LLNIPIN 262

  Fly   299 EVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQFEVIFPEVINPSVVPTLKQCL 350
            :::..:..|.:..||||:.:||.:||.|.|.|::.||..:.|.....|:|.|
Mouse   263 DIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 109/378 (29%)
DnaJ 7..65 CDD:278647 32/60 (53%)
DnaJ_C 112..336 CDD:199909 55/224 (25%)
DnaJ_zf 140..206 CDD:199908 2/66 (3%)
Dnajb13NP_705755.2 DnaJ 1..312 CDD:223560 107/374 (29%)
DnaJ 4..65 CDD:278647 32/60 (53%)
DnaJ_C 138..302 CDD:199909 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.