DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and Dnajb11

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001177733.1 Gene:Dnajb11 MGIID:1915088 Length:358 Species:Mus musculus

Alignment Length:360 Identity:131/361 (36%)
Similarity:182/361 (50%) Gaps:50/361 (14%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQVYDEGG 68
            :|.||||..:|:..::|||||||||:.|||:||::   .|||:.:..|||||||::||:.||..|
Mouse    26 FYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYG 90

  Fly    69 EAAIKKGGADSGDFRNPMDFFEKFFG-AGFGGSGGGRRRER---RGKDVVHQMSVQLEELYNGAT 129
            |..:|.|...|..     |.|..||| .||...|..|:::|   ||.|::..:.|.|||:|.|..
Mouse    91 EEGLKDGHQSSHG-----DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNF 150

  Fly   130 RKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQ 194
            .::...|.|    .....||:    || .||   .|.|..|:.||..|..::|.           
Mouse   151 VEVVRNKPV----ARQAPGKR----KC-NCR---QEMRTTQLGPGRFQMTQEVV----------- 192

  Fly   195 EKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAH 259
                |..|...|.|.|.:.|||.||.|:|||.:..|.|||:...:.:|||:...:...:|..|..
Mouse   193 ----CDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHRIFER 253

  Fly   260 AGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVS----TQPGEVIRHEMTKCIAEEGMPIFKNP 320
            .|.||...:.:.|||||.||:..:..||...:.:|    |:||..:..:      .||:|.|.|.
Mouse   254 RGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLWKK------GEGLPNFDNN 312

  Fly   321 MEKGTLIIQFEVIFP-EVINPSVVPTLKQCLPPAP 354
            ..||:|||.|:|.|| |.:.......:||.|...|
Mouse   313 NIKGSLIITFDVDFPKEQLTEEAKEGIKQLLKQGP 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 131/361 (36%)
DnaJ 7..65 CDD:278647 33/61 (54%)
DnaJ_C 112..336 CDD:199909 75/229 (33%)
DnaJ_zf 140..206 CDD:199908 15/66 (23%)
Dnajb11NP_001177733.1 DnaJ 22..344 CDD:223560 130/356 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.