DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajb2

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001073462.1 Gene:dnajb2 ZFINID:ZDB-GENE-061013-537 Length:389 Species:Danio rerio

Alignment Length:326 Identity:90/327 (28%)
Similarity:119/327 (36%) Gaps:103/327 (31%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE----KFKAISQAYEVLSDADKRQVYDEG 67
            |||:|||..:|:||::|||||||||::||||||:..|    |||.|::|||||||..||..||..
Zfish     4 YYDVLGVSRSASPDDIKKAYRKLALQWHPDKNPDNKEEAEKKFKEIAEAYEVLSDKSKRDDYDRY 68

  Fly    68 GEAAIKKGGADSG------------DFRNPMDFFEKFFGA-----------GFGGSGGGRRRERR 109
            |.:.:...|:.|.            .||:|.:.|.:|||.           .|||...|.....|
Zfish    69 GRSDMPSSGSGSSGSFPDDFPGFTFTFRSPDEVFREFFGGQDPFADFFDDFPFGGMHSGFHSSSR 133

  Fly   110 GKDVVHQMSVQLEELYNGATRKLQLQK-----NVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQ 169
                            .|.:|......     ........|.|...|:..|.:     ...|||.
Zfish   134 ----------------LGPSRFFSFPSANADFTSFSSSLGGMGSMGGANFKSV-----STSTRVV 177

  Fly   170 QIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVF---T 231
                               .|:.:..|...:|...|..|.|..||:..:..|:.|...:..   .
Zfish   178 -------------------NGKRLTTKKVRENGQERTEVEEDGVLKSVLINGVEDEMALALELSR 223

  Fly   232 GEGDHEP---ESQPGDIIILLDEKEHST------------FAHA--------GQDLMMKMPLQLV 273
            .|...||   ..||     ||....||:            |.|.        .:||.|.:...|.
Zfish   224 REQSSEPPRQSHQP-----LLRPNNHSSPNPALRSYSAAPFYHCPSSNEDEEDEDLQMALAYSLS 283

  Fly   274 E 274
            |
Zfish   284 E 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 90/327 (28%)
DnaJ 7..65 CDD:278647 39/62 (63%)
DnaJ_C 112..336 CDD:199909 35/195 (18%)
DnaJ_zf 140..206 CDD:199908 11/66 (17%)
dnajb2NP_001073462.1 DnaJ 2..>108 CDD:223560 50/104 (48%)
DnaJ 3..66 CDD:278647 39/62 (63%)
UIM 269..285 CDD:280900 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.