DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajc10

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001077016.1 Gene:dnajc10 ZFINID:ZDB-GENE-070327-1 Length:791 Species:Danio rerio

Alignment Length:381 Identity:84/382 (22%)
Similarity:144/382 (38%) Gaps:137/382 (36%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE---GEKFKAISQAYEVLSDADKRQVYDEGG 68
            ||.:||:...|:..::::|::||||..|||||||:   .:||..|::|||||.|.|.|:.||:.|
Zfish    34 YYKLLGISREASTRDIRQAFKKLALTMHPDKNPNDETAHDKFLKINRAYEVLKDEDLRKKYDKYG 98

  Fly    69 EAAI---KKGG-----------------------ADSGDFRNPMDFFEKFF-------------- 93
            |..:   ::||                       .|.|||...::..|.:|              
Zfish    99 EKGLQDEQQGGRYESWNYYRYDFGIYDDDPEITTLDRGDFDAAVNSGEVWFVNFYFPRCSHCHDL 163

  Fly    94 -----------------GAGFGGSGGGRRRERRGKDV-------VHQMSVQLEELYNGATRKLQL 134
                             ||...|..|   ...|.|.:       |.:..:..|:.:|..|     
Zfish   164 APTWREFAKEMDGVIRIGAVNCGDNG---MLCRSKGINSYPSLYVFRAGMNPEKYFNDRT----- 220

  Fly   135 QKNVICDKCEGRGGKKGSIEK-CLQCRGNGVETRVQQIAPG-IMQHIEQVCRK--------CSGT 189
                           |.|:.| .:|.    |:::|.::..| |...||:...:        |:.|
Zfish   221 ---------------KSSLTKFAMQF----VKSKVTELWQGNIYSEIERAFAERIGWLITFCADT 266

  Fly   190 GETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEH 254
            |:.::.:.|            ||:      .||.||  :|..|..|...::.      |.:..|.
Zfish   267 GDCLESQTR------------RKL------AGMLDG--LVNVGWMDCTKQAD------LCESFEI 305

  Fly   255 STFAHA----GQDLMMKMPLQLVEALCG---FQRIVKTLDDRDLIVSTQPGEVIRH 303
            :|...|    |..|..|..:..:::|..   :.::::.|.|.:::..:.....:.|
Zfish   306 NTSTTALFPPGSSLTQKGSVLFIQSLDTKEIYAQVLQHLPDLEILTKSSFEHKLAH 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 84/382 (22%)
DnaJ 7..65 CDD:278647 29/61 (48%)
DnaJ_C 112..336 CDD:199909 38/217 (18%)
DnaJ_zf 140..206 CDD:199908 14/76 (18%)
dnajc10NP_001077016.1 DnaJ 33..>129 CDD:223560 34/95 (36%)
DnaJ 33..95 CDD:278647 29/61 (48%)
PDI_a_ERdj5_N 128..228 CDD:239301 19/123 (15%)
ER_PDI_fam 129..648 CDD:273457 50/287 (17%)
Thioredoxin_like <276..318 CDD:294274 14/56 (25%)
PDI_a_family 348..443 CDD:239259 1/15 (7%)
PDI_a_ERdj5_C 450..546 CDD:239302
PDI_a_ERdj5_C 552..660 CDD:239302
PDI_a_ERdj5_C 666..772 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.