DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and DNAJA4

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_061072.3 Gene:DNAJA4 HGNCID:14885 Length:426 Species:Homo sapiens

Alignment Length:401 Identity:243/402 (60%)
Similarity:312/402 (78%) Gaps:9/402 (2%)


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYD 65
            |||||.|||||||||:|:|:|:|||||||||||||||||:||||||.||||||||||..||.|||
Human    30 MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDVYD 94

  Fly    66 EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGR-RRERRGKDVVHQMSVQLEELYNGAT 129
            :|||.|||:||:.|..|.:|||.|:.|||      |||| .||||||:||||:||.||:||||.|
Human    95 QGGEQAIKEGGSGSPSFSSPMDIFDMFFG------GGGRMARERRGKNVVHQLSVTLEDLYNGVT 153

  Fly   130 RKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQ 194
            :||.|||||||:||||.||||||:|||..|:|.|::..:|||.||::|.|:.||.:|.|.||.|.
Human   154 KKLALQKNVICEKCEGVGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERIN 218

  Fly   195 EKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAH 259
            .||||::|||.|.:||:|::|||:||||:|||||:|.||||.|||.:|||:||:||:|:||.|..
Human   219 PKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQR 283

  Fly   260 AGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKG 324
            .|.||:|||.:||.||||||::.:||||:|.|:::::.||||:|...:|:.:|||||:|.|:|||
Human   284 RGHDLIMKMKIQLSEALCGFKKTIKTLDNRILVITSKAGEVIKHGDLRCVRDEGMPIYKAPLEKG 348

  Fly   325 TLIIQFEVIFPEV--INPSVVPTLKQCLPPAPEVDIPIDAEQTVLEDFDPKQRRQQHQRMAYDED 387
            .|||||.|||||.  ::...:|.|:..|||..:|.|..|.:|..|::|.|.::..:..|.||:||
Human   349 ILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKEFCPNEQNWRQHREAYEED 413

  Fly   388 DGGYQDGPRVQ 398
            :.|.|.|.:.|
Human   414 EDGPQAGVQCQ 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 241/399 (60%)
DnaJ 7..65 CDD:278647 49/58 (84%)
DnaJ_C 112..336 CDD:199909 139/224 (62%)
DnaJ_zf 140..206 CDD:199908 38/66 (58%)
DNAJA4NP_061072.3 PTZ00037 15..423 CDD:240236 242/399 (61%)
DnaJ 36..94 CDD:278647 49/58 (84%)
DnaJ_C 135..361 CDD:199909 141/226 (62%)
DnaJ_zf 164..230 CDD:199908 38/66 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 1 1.000 H23110
Inparanoid 1 1.050 505 1.000 Inparanoid score I1330
Isobase 1 0.950 0 Normalized mean entropy S577
OMA 1 1.010
OrthoDB 1 1.010 D1012379at2759
OrthoFinder 1 1.000 FOG0000456
OrthoInspector 1 1.000 T609746
orthoMCL 1 0.900 OOG5_126883
Panther 1 1.100 LDO PTHR43888
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R684
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.