DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajb2

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_012825839.1 Gene:dnajb2 XenbaseID:XB-GENE-951530 Length:360 Species:Xenopus tropicalis

Alignment Length:331 Identity:94/332 (28%)
Similarity:131/332 (39%) Gaps:119/332 (36%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE----KFKAISQAYEVLSDADKRQVYDEG 67
            |||||||..||:.|::|:|||||||::||||||:..|    |||.|::|||||||.:||:.||. 
 Frog     4 YYDILGVPRNASQDDIKRAYRKLALRWHPDKNPDNKEHAERKFKDIAEAYEVLSDREKREAYDN- 67

  Fly    68 GEAAIKKGGADSG---------------DFRNPMDFFEKFFG----------------------- 94
                :..|.:|.|               .||:|.|.|..|||                       
 Frog    68 ----MTSGFSDPGAFRATRVQRPFDFGFQFRSPEDVFRDFFGGKDPFPDMIGDDVFMFPNHPHGV 128

  Fly    95 -----------AGF----------GGSGGGRR--------RERRGKDVVHQM-------SVQLEE 123
                       :.|          ||.||.|.        :...||.:..:.       .:::||
 Frog   129 THHANSVPMFPSSFHFGNEFSFHSGGLGGSRNFCSVSTSTKFVNGKRITTKRIMENDVERIEVEE 193

  Fly   124 -------LYNGATRKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPG--IMQHI 179
                   |.||....|.|.  |...|.|     :.|:.:. ..|.:|....:||.:||  ::|..
 Frog   194 DGELKSILVNGVEDDLALA--VELSKRE-----QASVPRA-SARTDGPSYNIQQRSPGTPVVQDR 250

  Fly   180 E------QVCRKCSGTGETIQEKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEP 238
            :      |:...|| ..|..|.:...:.      ||.:|.|      |...|.|....|:..::|
 Frog   251 DDEDEELQLAMACS-LSEFEQSRQHPEG------VRSKKQL------GKDSGAKQQAKGQCGYKP 302

  Fly   239 ESQPGD 244
            ..|.||
 Frog   303 TLQEGD 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 94/332 (28%)
DnaJ 7..65 CDD:278647 39/62 (63%)
DnaJ_C 112..336 CDD:199909 35/156 (22%)
DnaJ_zf 140..206 CDD:199908 15/74 (20%)
dnajb2XP_012825839.1 DnaJ 2..>106 CDD:223560 51/107 (48%)
DnaJ 3..66 CDD:278647 39/62 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.