DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnaja1

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001011012.1 Gene:dnaja1 XenbaseID:XB-GENE-976936 Length:400 Species:Xenopus tropicalis

Alignment Length:408 Identity:245/409 (60%)
Similarity:310/409 (76%) Gaps:13/409 (3%)


  Fly     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADKRQVYD 65
            ||.||.||||||||||:|||||||||||||||||||||||||||||.||||||||||:.||.:||
 Frog     1 MVVETAYYDILGVKPNSTPDELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDSKKRDLYD 65

  Fly    66 EGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGGGR-RRERRGKDVVHQMSVQLEELYNGAT 129
            :|||.|||:||...|.|.:|||.|:.|||      |||| :||||||:||||:||.||:||||||
 Frog    66 KGGEQAIKEGGMGGGGFASPMDIFDMFFG------GGGRMQRERRGKNVVHQLSVSLEDLYNGAT 124

  Fly   130 RKLQLQKNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQ 194
            |||.:|||.|||||||||||||::|.|..|||.|::.|:.|:.||::|.|:.||.:|.|.||.|.
 Frog   125 RKLAVQKNTICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQLGPGMVQQIQSVCPECQGQGERIN 189

  Fly   195 EKDRCKNCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAH 259
            .|||||:|:|||.|||:|:|||||:|||:|||||.|:||||.||..:.|||||:||:|:||.|..
 Frog   190 PKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFSGEGDQEPGLEAGDIIIVLDQKDHSVFTR 254

  Fly   260 AGQDLMMKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKG 324
            ..:||::.|.::|||||||||:.:.|||.|.:|:::.||::::|...||:..|||||::.|.:||
 Frog   255 RNEDLIIHMEIELVEALCGFQKPIVTLDSRTIIITSHPGQIVKHGDVKCVLNEGMPIYRRPYDKG 319

  Fly   325 TLIIQFEVIFP--EVINPSVVPTLKQCLPPAPEVDIPIDAEQTVLEDFDPKQRRQQH-QRMAYDE 386
            .||:||:|.||  ..|:|..:|.|::.||...|::...|.||..|.||||.|:|::| ...||.:
 Frog   320 RLIVQFQVNFPASNSISPDKLPLLEKLLPARKEIEETEDMEQAELMDFDPSQQRRRHFNGEAYHD 384

  Fly   387 DDGGYQDGPRV-QQCTSS 403
            ||.  .|.||. .||.:|
 Frog   385 DDD--DDHPRSGVQCQTS 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 241/401 (60%)
DnaJ 7..65 CDD:278647 52/58 (90%)
DnaJ_C 112..336 CDD:199909 133/226 (59%)
DnaJ_zf 140..206 CDD:199908 39/66 (59%)
dnaja1NP_001011012.1 DnaJ 7..397 CDD:333066 239/398 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89577511
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 503 1.000 Inparanoid score I1235
OMA 1 1.010
OrthoDB 1 1.010 D1012379at2759
OrthoFinder 1 1.000 FOG0000456
OrthoInspector 1 1.000 T601607
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R684
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.