DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajb1

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001008112.1 Gene:dnajb1 XenbaseID:XB-GENE-1003017 Length:350 Species:Xenopus tropicalis

Alignment Length:411 Identity:123/412 (30%)
Similarity:186/412 (45%) Gaps:132/412 (32%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEG--EKFKAISQAYEVLSDADKRQVYDEGGE 69
            ||.|||:...||.:|:||||||.|||||||||.:.|  ::||.|::||:||||..||:|:|:.||
 Frog     5 YYKILGIPKGATEEEIKKAYRKQALKYHPDKNKDPGAEDRFKEIAEAYDVLSDPKKREVFDKYGE 69

  Fly    70 AAIK---KGGADSG-------------------DF---RNPMDFFEKFFG------------AGF 97
            ..:|   .||..||                   :|   |||   |:.|||            |||
 Frog    70 EGLKGTPGGGGSSGGPNGTYSYTFHGDPHAVFAEFFGGRNP---FDGFFGRNDDDMDTDDPFAGF 131

  Fly    98 GGSGG------------------------GRR---RERRGKDVVHQMSVQLEELYNGATRKLQLQ 135
            ||.||                        |||   ..::...:..::.|.|||::||.|:|:::.
 Frog   132 GGMGGFGGMGGMGGMGGMGGMGGFPRSASGRRDTVPRKQDPPITRELPVSLEEVFNGCTKKMKIS 196

  Fly   136 KNVICDKCEGRGGKKGSIEKCLQCRGNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCK 200
            .                                :::.|                           
 Frog   197 H--------------------------------KRLGP--------------------------- 202

  Fly   201 NCSGRKTVRERKVLEVHIEKGMRDGQKIVFTGEGDHEPESQPGDIIILLDEKEHSTFAHAGQDLM 265
              .||....|.|:|.:.::||.::|.||.|..|||..|.:.|.||:.:|.:|.|..|...|.|::
 Frog   203 --DGRSVRNEDKILTIQVKKGWKEGTKITFPKEGDETPSNIPADIVFVLKDKSHPVFKREGSDVV 265

  Fly   266 MKMPLQLVEALCGFQRIVKTLDDRDLIVSTQPGEVIRHEMTKCIAEEGMPIFKNPMEKGTLIIQF 330
            ....:.|.|||||....:.|:|:|.:.::..  ::||....:.|..||:|:.|:|.::|.||::|
 Frog   266 YTSKISLREALCGCSVNIPTVDNRTIPLTFT--DIIRPGTKRRITNEGLPLPKSPDQRGDLIVEF 328

  Fly   331 EVIFPEVINPSVVPTLKQCLP 351
            ::.|||.:..|....|::.||
 Frog   329 DIRFPERLTASSREVLERVLP 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 123/412 (30%)
DnaJ 7..65 CDD:278647 36/60 (60%)
DnaJ_C 112..336 CDD:199909 56/224 (25%)
DnaJ_zf 140..206 CDD:199908 3/66 (5%)
dnajb1NP_001008112.1 DnaJ 1..345 CDD:223560 121/406 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.