DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Droj2 and dnajb1

DIOPT Version :10

Sequence 1:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001008112.1 Gene:dnajb1 / 493474 XenbaseID:XB-GENE-1003017 Length:350 Species:Xenopus tropicalis


Alignment Length:39 Identity:12/39 - (30%)
Similarity:15/39 - (38%) Gaps:12/39 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 MTNPIGSPASTPNRFPSNNSANLPTTNFVPQTSQMYAGL 187
            |.||...|.:            |.|||..|.|..:.:||
 Frog   110 MLNPKVQPLT------------LATTNVRPGTVCLLSGL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 12/39 (31%)
dnajb1NP_001008112.1 DnaJ_bact 4..345 CDD:274090 12/39 (31%)

Return to query results.
Submit another query.