DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and CG5504

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_995932.1 Gene:CG5504 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster

Alignment Length:344 Identity:105/345 (30%)
Similarity:153/345 (44%) Gaps:77/345 (22%)


  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN---PNEGEKFKAISQAYEVLSDADKRQVYDEGG 68
            ||..|||..||...::||||.:||.|||||.|   |:.|.||:.:|:|||||||..||:.||..|
  Fly    66 YYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPDAGRKFQEVSEAYEVLSDEQKRREYDTYG 130

  Fly    69 EAAI---KKGG---------------ADSGDFR---NPMDFFEKFFGAG---------FGGS--G 101
            :.|.   ::||               :.|..||   :|.:.|.|.||.|         |..|  |
  Fly   131 QTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKFG 195

  Fly   102 GGRRRERRGKDVVHQMSVQLEELYNGATRKLQLQKNVI--CDKCEGR----GGKKGSIEKCLQCR 160
            .|:.:|.       .|.:...:...|..:.:.:  ||:  |.||.|.    |.|.|   :|..|.
  Fly   196 FGQAQEM-------VMDLTFAQAARGVNKDVNV--NVVDQCPKCAGTKCEPGTKPG---RCQYCN 248

  Fly   161 GNGVETRVQQIAPGIMQHIEQVCRKCSGTGETIQEKDRCKNCSGR-KTVRERKVLEVHIEKGMRD 224
            |.|.||  ....|.:|:   ..||.|.||.:.|  |..|..|.|: :||:.||| .|.:..|:.:
  Fly   249 GTGFET--VSTGPFVMR---STCRYCQGTRQHI--KYPCSECEGKGRTVQRRKV-TVPVPAGIEN 305

  Fly   225 GQKIVFTGEGDHEPESQPG--DIIILLDEKEHSTFAHAGQDLMMKMPLQLVEA-LCGFQRIVKTL 286
            ||.:          ..|.|  ::.:....:....|...|.|:.....:.|.:| |.|..|:....
  Fly   306 GQTV----------RMQVGSKELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVY 360

  Fly   287 DDRDLIVSTQPGEVIRHEM 305
            :|:  .::.:||....|::
  Fly   361 EDQ--WINVEPGTSSHHKI 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 105/345 (30%)
DnaJ 7..65 CDD:278647 34/61 (56%)
DnaJ_C 112..336 CDD:199909 52/205 (25%)
DnaJ_zf 140..206 CDD:199908 25/71 (35%)
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 105/345 (30%)
DnaJ 65..127 CDD:278647 34/61 (56%)
DnaJ_zf 227..287 CDD:199908 25/70 (36%)
DnaJ_C 288..409 CDD:199909 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89585659
eggNOG 1 0.900 E1_COG0484
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.