DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Droj2 and dnajc7

Sequence 1:NP_650283.1 Gene:Droj2 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_012827094.1 Gene:dnajc7 XenbaseID:XB-GENE-946345 Length:497 Species:Xenopus tropicalis

Alignment Length:108 Identity:46/109 (42%)
Similarity:64/109 (59%) Gaps:15/109 (14%)


  Fly     3 KETGYYDILGVKPNATPDELKKAYRKLALKYHPDKN--------PNEGEKFKAISQAYEVLSDAD 59
            |...||.||||..||:.||:||||||.||.:|||::        ..|.:|||.:.:|:.|||||.
 Frog   377 KRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSAATAEVQKEEEKKFKEVGEAFTVLSDAK 441

  Fly    60 KRQVYDEGGEAAIKKGGADSGDFRNPMDFFEKFFGAGFGGSGG 102
            |:..||.|.:  :::.|.:.||| :..:.|:.|    |.|.||
 Frog   442 KKARYDSGQD--LEEDGLNMGDF-DANNIFKAF----FSGPGG 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 46/109 (42%)
DnaJ 7..65 CDD:278647 33/66 (50%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
dnajc7XP_012827094.1 TPR_11 29..91 CDD:290150
TPR repeat 29..55 CDD:276809
TPR_11 60..126 CDD:290150
TPR repeat 60..90 CDD:276809
TPR repeat 95..123 CDD:276809
TPR repeat 144..169 CDD:276809
TPR repeat 174..204 CDD:276809
TPR repeat 209..237 CDD:276809
TPR_11 256..323 CDD:290150
TPR repeat 256..283 CDD:276809
TPR repeat 288..322 CDD:276809
TPR_11 292..355 CDD:290150
TPR_1 293..326 CDD:278916
TPR repeat 327..355 CDD:276809
DnaJ 380..447 CDD:278647 33/67 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.